BLASTX nr result
ID: Akebia23_contig00021907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00021907 (229 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004306629.1| PREDICTED: auxin-induced protein X15-like [F... 64 2e-08 gb|EXB83845.1| hypothetical protein L484_023452 [Morus notabilis] 63 5e-08 ref|XP_002320219.1| auxin-responsive family protein [Populus tri... 63 5e-08 ref|XP_006444768.1| hypothetical protein CICLE_v10022948mg [Citr... 62 1e-07 ref|XP_004133791.1| PREDICTED: auxin-induced protein 15A-like [C... 60 3e-07 ref|XP_006441210.1| hypothetical protein CICLE_v10022912mg [Citr... 59 5e-07 ref|XP_007218348.1| hypothetical protein PRUPE_ppa010986mg [Prun... 59 5e-07 ref|XP_002301429.2| auxin-responsive family protein [Populus tri... 59 7e-07 ref|XP_006493175.1| PREDICTED: auxin-induced protein 10A5-like [... 58 1e-06 ref|XP_004155191.1| PREDICTED: auxin-induced protein 15A-like [C... 58 1e-06 ref|NP_001240001.1| uncharacterized protein LOC100808516 [Glycin... 58 2e-06 ref|XP_002263012.1| PREDICTED: auxin-induced protein 10A5 [Vitis... 57 2e-06 ref|XP_007135297.1| hypothetical protein PHAVU_010G117500g [Phas... 56 5e-06 ref|XP_003528773.1| PREDICTED: auxin-induced protein 10A5-like [... 55 8e-06 >ref|XP_004306629.1| PREDICTED: auxin-induced protein X15-like [Fragaria vesca subsp. vesca] Length = 115 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSV--QHHHHNVGCFR 132 IPCHVEEFR+VQGMID+ERSV HHHH+VGCFR Sbjct: 81 IPCHVEEFRYVQGMIDRERSVHGHHHHHHVGCFR 114 >gb|EXB83845.1| hypothetical protein L484_023452 [Morus notabilis] Length = 128 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSVQHHHHNVGC 138 IPCHVEEFR+VQGMID+E+S+ HHHH+VGC Sbjct: 94 IPCHVEEFRYVQGMIDREKSLHHHHHHVGC 123 >ref|XP_002320219.1| auxin-responsive family protein [Populus trichocarpa] gi|222860992|gb|EEE98534.1| auxin-responsive family protein [Populus trichocarpa] Length = 110 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSVQHHHHNVGCFRA 129 IPCHVEEFR+VQGMID+E+S+ HHHH VGCFRA Sbjct: 79 IPCHVEEFRNVQGMIDREKSI-HHHHLVGCFRA 110 >ref|XP_006444768.1| hypothetical protein CICLE_v10022948mg [Citrus clementina] gi|567904562|ref|XP_006444769.1| hypothetical protein CICLE_v10022948mg [Citrus clementina] gi|568876553|ref|XP_006491342.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like isoform X1 [Citrus sinensis] gi|568876555|ref|XP_006491343.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like isoform X2 [Citrus sinensis] gi|557547030|gb|ESR58008.1| hypothetical protein CICLE_v10022948mg [Citrus clementina] gi|557547031|gb|ESR58009.1| hypothetical protein CICLE_v10022948mg [Citrus clementina] Length = 112 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSVQHHHHNVGCFR 132 IPCHVEEFR+VQGMID+E S+ HHHH+VGCFR Sbjct: 81 IPCHVEEFRYVQGMIDRENSL-HHHHHVGCFR 111 >ref|XP_004133791.1| PREDICTED: auxin-induced protein 15A-like [Cucumis sativus] Length = 111 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/43 (62%), Positives = 30/43 (69%), Gaps = 11/43 (25%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSV-----------QHHHHNVGCFR 132 IPCHVEEFRHVQGMID+E S QHHHH++GCFR Sbjct: 66 IPCHVEEFRHVQGMIDRENSFHRRHNHHHHQQQHHHHHLGCFR 108 >ref|XP_006441210.1| hypothetical protein CICLE_v10022912mg [Citrus clementina] gi|557543472|gb|ESR54450.1| hypothetical protein CICLE_v10022912mg [Citrus clementina] Length = 118 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/35 (74%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSV--QHHHHNVGCFRA 129 +PCHVEEFR VQGMIDK+RS+ HHHH+V CFRA Sbjct: 84 LPCHVEEFRTVQGMIDKDRSLLHHHHHHHVWCFRA 118 >ref|XP_007218348.1| hypothetical protein PRUPE_ppa010986mg [Prunus persica] gi|462414810|gb|EMJ19547.1| hypothetical protein PRUPE_ppa010986mg [Prunus persica] Length = 228 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 5/37 (13%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSV-----QHHHHNVGCFR 132 IPCHVEEFR+VQGMID+E+S+ HHHH VGCFR Sbjct: 191 IPCHVEEFRYVQGMIDREKSLHHPHHHHHHHVVGCFR 227 >ref|XP_002301429.2| auxin-responsive family protein [Populus trichocarpa] gi|550345239|gb|EEE80702.2| auxin-responsive family protein [Populus trichocarpa] Length = 113 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSVQHHHHNVGCFR 132 IPCHVEEFR+VQGMIDKE+ + HHH+VGCFR Sbjct: 83 IPCHVEEFRYVQGMIDKEKPI--HHHHVGCFR 112 >ref|XP_006493175.1| PREDICTED: auxin-induced protein 10A5-like [Citrus sinensis] Length = 121 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 30/38 (78%), Gaps = 5/38 (13%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSV-----QHHHHNVGCFRA 129 +PCHVEEFR VQGMIDK+RS+ HHHH+V CFRA Sbjct: 84 LPCHVEEFRTVQGMIDKDRSLLHHHHHHHHHHVWCFRA 121 >ref|XP_004155191.1| PREDICTED: auxin-induced protein 15A-like [Cucumis sativus] Length = 111 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 11/43 (25%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSV-----------QHHHHNVGCFR 132 IPCHVEEFRHVQGMID+E S HHHH++GCFR Sbjct: 66 IPCHVEEFRHVQGMIDRENSFHRRHNHHHHHQHHHHHHLGCFR 108 >ref|NP_001240001.1| uncharacterized protein LOC100808516 [Glycine max] gi|255637197|gb|ACU18929.1| unknown [Glycine max] Length = 123 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSVQHHHHNVGCFR 132 IPCHV++FR+VQG+IDKE+S QH HH + CFR Sbjct: 87 IPCHVKDFRYVQGLIDKEKSSQHQHHVISCFR 118 >ref|XP_002263012.1| PREDICTED: auxin-induced protein 10A5 [Vitis vinifera] Length = 115 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%), Gaps = 5/37 (13%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSV-----QHHHHNVGCFR 132 IPCHVEEFR+VQGMID+E S+ HHHH+ GCFR Sbjct: 78 IPCHVEEFRYVQGMIDREHSLHPQNHNHHHHHGGCFR 114 >ref|XP_007135297.1| hypothetical protein PHAVU_010G117500g [Phaseolus vulgaris] gi|561008342|gb|ESW07291.1| hypothetical protein PHAVU_010G117500g [Phaseolus vulgaris] Length = 108 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/31 (70%), Positives = 30/31 (96%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSVQHHHHNVGCF 135 IPCHVEEFR+V+G+ID+++S+ HHHH+VGCF Sbjct: 77 IPCHVEEFRNVRGLIDRDKSL-HHHHHVGCF 106 >ref|XP_003528773.1| PREDICTED: auxin-induced protein 10A5-like [Glycine max] Length = 115 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/34 (64%), Positives = 30/34 (88%), Gaps = 3/34 (8%) Frame = -3 Query: 227 IPCHVEEFRHVQGMIDKERSV---QHHHHNVGCF 135 IPCHVEEFR+V+G+ID+++S+ HHHH+VGCF Sbjct: 80 IPCHVEEFRNVRGLIDRDKSLHHHHHHHHHVGCF 113