BLASTX nr result
ID: Akebia23_contig00020479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00020479 (1217 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515001.1| pentatricopeptide repeat-containing protein,... 62 5e-07 ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-06 ref|XP_007044993.1| Tetratricopeptide repeat (TPR)-like superfam... 59 5e-06 >ref|XP_002515001.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546052|gb|EEF47555.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 466 Score = 62.0 bits (149), Expect = 5e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 1084 AFDKMVDILGKAKQMDRMQLLLEEMRDGNHITRKTITKVMRRLA 1215 A+D MVDI+GK KQMD+M+ LLEEM G H+T KT+ K MRR A Sbjct: 87 AYDTMVDIMGKMKQMDQMEFLLEEMEKGQHVTLKTVGKAMRRFA 130 >ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Vitis vinifera] Length = 496 Score = 59.3 bits (142), Expect = 3e-06 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +1 Query: 1057 GHIHAMNILAFDKMVDILGKAKQMDRMQLLLEEMRDGNHITRKTITKVMRRLA 1215 G+ HA A+D MVDILGK KQ+D+M+ L+EEMR GN + T+ K MRRLA Sbjct: 107 GYEHAPE--AYDMMVDILGKLKQVDKMRALMEEMRQGNLVRLSTVAKAMRRLA 157 >ref|XP_007044993.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508708928|gb|EOY00825.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 504 Score = 58.5 bits (140), Expect = 5e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +1 Query: 1084 AFDKMVDILGKAKQMDRMQLLLEEMRDGNHITRKTITKVMRRLA 1215 A+D MVDILGK KQMD M+ LEEMR G+ +T TI KVMRR A Sbjct: 125 AYDLMVDILGKMKQMDHMKDFLEEMRQGHFVTLNTIAKVMRRFA 168