BLASTX nr result
ID: Akebia23_contig00020268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00020268 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270524.1| PREDICTED: U-box domain-containing protein 1... 74 2e-11 ref|XP_003556245.1| PREDICTED: U-box domain-containing protein 1... 70 2e-10 ref|XP_006436481.1| hypothetical protein CICLE_v10030962mg [Citr... 70 3e-10 ref|XP_006424807.1| hypothetical protein CICLE_v10027966mg [Citr... 70 4e-10 ref|XP_002311996.1| armadillo/beta-catenin repeat family protein... 69 7e-10 ref|XP_004157535.1| PREDICTED: U-box domain-containing protein 1... 67 3e-09 ref|XP_004142402.1| PREDICTED: U-box domain-containing protein 1... 67 3e-09 ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 1... 67 3e-09 ref|XP_002315320.1| armadillo/beta-catenin repeat family protein... 66 4e-09 ref|XP_007009958.1| U-box domain-containing protein 14 [Theobrom... 66 6e-09 gb|AFK37700.1| unknown [Lotus japonicus] 65 1e-08 ref|XP_004307361.1| PREDICTED: U-box domain-containing protein 1... 65 1e-08 ref|XP_002534105.1| Spotted leaf protein, putative [Ricinus comm... 64 2e-08 ref|XP_006833209.1| hypothetical protein AMTR_s00072p00171260 [A... 64 3e-08 ref|XP_004294506.1| PREDICTED: U-box domain-containing protein 1... 64 3e-08 ref|XP_004250057.1| PREDICTED: U-box domain-containing protein 1... 62 8e-08 ref|XP_004250056.1| PREDICTED: U-box domain-containing protein 1... 62 8e-08 ref|XP_003535520.1| PREDICTED: U-box domain-containing protein 1... 62 8e-08 gb|EXC10629.1| U-box domain-containing protein 13 [Morus notabilis] 62 1e-07 ref|XP_007143751.1| hypothetical protein PHAVU_007G098700g [Phas... 62 1e-07 >ref|XP_002270524.1| PREDICTED: U-box domain-containing protein 14 [Vitis vinifera] Length = 628 Score = 74.3 bits (181), Expect = 2e-11 Identities = 39/59 (66%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -1 Query: 174 EDSKEVIV--QLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEE 4 +DS ++ V QL V+EISG PECRNT KK Y NL RRVKLLSPLFEELKD E LE+ Sbjct: 5 KDSNKISVLNQLLAVVKEISGLPECRNTTKKMYYNLVRRVKLLSPLFEELKDSEEELED 63 >ref|XP_003556245.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max] Length = 631 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 1/59 (1%) Frame = -1 Query: 174 EDSKEVIV-QLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEE 1 E SK V++ +L E ++EISG PEC+N K+ Y NL RRVKLLSPLFEELKDG+ L +E Sbjct: 5 ESSKGVVMGRLVECIKEISGLPECQNLCKRVYGNLVRRVKLLSPLFEELKDGDESLSDE 63 >ref|XP_006436481.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] gi|568864439|ref|XP_006485606.1| PREDICTED: U-box domain-containing protein 14-like [Citrus sinensis] gi|557538677|gb|ESR49721.1| hypothetical protein CICLE_v10030962mg [Citrus clementina] Length = 627 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/55 (61%), Positives = 45/55 (81%), Gaps = 1/55 (1%) Frame = -1 Query: 162 EVIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDG-EGVLEEE 1 EV+ +L ++V+E+SG PEC+N KK + NL RRVKLLSPLFEEL+DG EG+ +EE Sbjct: 9 EVLSRLVDSVKEVSGLPECKNFFKKMHGNLVRRVKLLSPLFEELRDGNEGLSQEE 63 >ref|XP_006424807.1| hypothetical protein CICLE_v10027966mg [Citrus clementina] gi|568870221|ref|XP_006488304.1| PREDICTED: U-box domain-containing protein 13-like [Citrus sinensis] gi|557526741|gb|ESR38047.1| hypothetical protein CICLE_v10027966mg [Citrus clementina] Length = 661 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/60 (56%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = -1 Query: 177 MEDSKEVIVQ-LFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEE 1 MED K V+VQ L +TV EIS + R T+KKQYCNL+RR+KLL+P+FEE+K+ + + EE Sbjct: 1 MEDEKGVLVQSLIDTVNEISTISDYRGTVKKQYCNLARRLKLLTPMFEEIKESKEAIPEE 60 >ref|XP_002311996.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222851816|gb|EEE89363.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 628 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/62 (53%), Positives = 45/62 (72%) Frame = -1 Query: 186 SVLMEDSKEVIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLE 7 S+ + S E++ +L ++V+EISG PECRN KK + +L RR+KLLSP+FEELKD L Sbjct: 2 SLTGDPSSELLSRLVDSVKEISGLPECRNVFKKTHGDLVRRIKLLSPMFEELKDNNEELS 61 Query: 6 EE 1 EE Sbjct: 62 EE 63 >ref|XP_004157535.1| PREDICTED: U-box domain-containing protein 14-like [Cucumis sativus] Length = 627 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -1 Query: 159 VIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLE 7 V+ QL E+VREISG PEC KK Y +L RRVKLLSPLFEEL+DGE +E Sbjct: 9 VVNQLPESVREISGLPECNGICKKMYGDLIRRVKLLSPLFEELRDGEEEVE 59 >ref|XP_004142402.1| PREDICTED: U-box domain-containing protein 14-like [Cucumis sativus] Length = 627 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -1 Query: 159 VIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLE 7 V+ QL E+VREISG PEC KK Y +L RRVKLLSPLFEEL+DGE +E Sbjct: 9 VVNQLPESVREISGLPECNGICKKMYGDLIRRVKLLSPLFEELRDGEEEVE 59 >ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 14-like [Cicer arietinum] Length = 630 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 174 EDSKEVIV-QLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGE 19 E+SK ++V +L +++R+ISG PEC+N K+ Y NL RRVKLLSPLFEELKD + Sbjct: 5 ENSKAMVVNRLADSIRDISGLPECQNVCKRMYGNLIRRVKLLSPLFEELKDSD 57 >ref|XP_002315320.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222864360|gb|EEF01491.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 628 Score = 66.2 bits (160), Expect = 4e-09 Identities = 36/62 (58%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Frame = -1 Query: 183 VLMED-SKEVIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLE 7 VL ED + E++ L ++V+EIS PECRN KK + NL RR+KLLSPLFEELKD L Sbjct: 2 VLTEDPNSELMSGLVDSVKEISMSPECRNVCKKMHGNLVRRIKLLSPLFEELKDNNEELS 61 Query: 6 EE 1 EE Sbjct: 62 EE 63 >ref|XP_007009958.1| U-box domain-containing protein 14 [Theobroma cacao] gi|508726871|gb|EOY18768.1| U-box domain-containing protein 14 [Theobroma cacao] Length = 637 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/51 (62%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -1 Query: 171 DSK-EVIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDG 22 DSK E++ QL E V+EI+G P+C+N+ KK + NL RR+KLLSPLFEEL+DG Sbjct: 8 DSKGELLSQLAELVKEITGLPDCKNSCKKTHGNLVRRIKLLSPLFEELRDG 58 >gb|AFK37700.1| unknown [Lotus japonicus] Length = 94 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/59 (55%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -1 Query: 174 EDSKEVIV-QLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEE 1 E+ K +V L ET++EISG PEC+N K+ N+ RRVKLLSPLFEELKD + L +E Sbjct: 5 ENPKSAVVGSLVETIKEISGLPECQNVHKRMCGNMVRRVKLLSPLFEELKDSDESLSDE 63 >ref|XP_004307361.1| PREDICTED: U-box domain-containing protein 14-like [Fragaria vesca subsp. vesca] Length = 627 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = -1 Query: 165 KEVIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEE 1 K V+ QL ++V+ IS PECRN +K Y N RRVKLLSPLFEEL+D + L EE Sbjct: 10 KMVLSQLVDSVKAISELPECRNVFRKMYGNFVRRVKLLSPLFEELRDSDKQLGEE 64 >ref|XP_002534105.1| Spotted leaf protein, putative [Ricinus communis] gi|223525845|gb|EEF28280.1| Spotted leaf protein, putative [Ricinus communis] Length = 662 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/61 (49%), Positives = 46/61 (75%), Gaps = 2/61 (3%) Frame = -1 Query: 177 MEDSKE--VIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEE 4 MED ++ ++ L ETV EI+ E R+T+KKQYCNL+RR+KLL P+FEE+K+ + ++E Sbjct: 1 MEDQEKGALVESLIETVNEIASISEYRSTVKKQYCNLARRLKLLIPMFEEIKESKEPIQE 60 Query: 3 E 1 + Sbjct: 61 Q 61 >ref|XP_006833209.1| hypothetical protein AMTR_s00072p00171260 [Amborella trichopoda] gi|548837860|gb|ERM98487.1| hypothetical protein AMTR_s00072p00171260 [Amborella trichopoda] Length = 630 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = -1 Query: 174 EDSKEVIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEE 1 E+ ++++ L + V+EIS PE RN +KQY NL RRVKLL PLFEELK+ L +E Sbjct: 4 EEGEDIVQSLIDLVKEISELPEWRNPWRKQYYNLVRRVKLLGPLFEELKESSETLNDE 61 >ref|XP_004294506.1| PREDICTED: U-box domain-containing protein 13-like [Fragaria vesca subsp. vesca] Length = 676 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 2/61 (3%) Frame = -1 Query: 177 MEDSKEVIVQ-LFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKD-GEGVLEE 4 ME+ K +VQ L +TV EI+ + R T+KKQYCNL+RR+KLL+P+FEE++D E V+ E Sbjct: 1 MEEDKGALVQSLIDTVNEIASISDYRCTVKKQYCNLARRLKLLTPMFEEIRDMKEAVVPE 60 Query: 3 E 1 E Sbjct: 61 E 61 >ref|XP_004250057.1| PREDICTED: U-box domain-containing protein 14-like isoform 2 [Solanum lycopersicum] Length = 586 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -1 Query: 165 KEVIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGV 13 +E+I +L E + +SG PECR+ K+ Y NL RRVKLLSPL E+LKD +GV Sbjct: 6 EELINELTELIDGVSGLPECRSVSKRMYSNLVRRVKLLSPLVEDLKDSDGV 56 >ref|XP_004250056.1| PREDICTED: U-box domain-containing protein 14-like isoform 1 [Solanum lycopersicum] Length = 624 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -1 Query: 165 KEVIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGV 13 +E+I +L E + +SG PECR+ K+ Y NL RRVKLLSPL E+LKD +GV Sbjct: 6 EELINELTELIDGVSGLPECRSVSKRMYSNLVRRVKLLSPLVEDLKDSDGV 56 >ref|XP_003535520.1| PREDICTED: U-box domain-containing protein 14-like [Glycine max] Length = 632 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/51 (64%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 174 EDSKEVIV-QLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKD 25 E SK V++ +L E ++EISG PE +N KK Y NL RRVKLLSPLFEELKD Sbjct: 5 ESSKGVVMSRLVECIKEISGLPESQNLCKKVYGNLVRRVKLLSPLFEELKD 55 >gb|EXC10629.1| U-box domain-containing protein 13 [Morus notabilis] Length = 664 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/58 (48%), Positives = 42/58 (72%) Frame = -1 Query: 174 EDSKEVIVQLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEE 1 E S +++ L E V EI+ E + T+KKQYCNL+RR+KLL+P+FEE++D + L +E Sbjct: 4 EKSGDLVQSLIELVGEIASISEYKCTVKKQYCNLARRLKLLTPMFEEIRDSKEALPQE 61 >ref|XP_007143751.1| hypothetical protein PHAVU_007G098700g [Phaseolus vulgaris] gi|561016941|gb|ESW15745.1| hypothetical protein PHAVU_007G098700g [Phaseolus vulgaris] Length = 631 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/59 (54%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = -1 Query: 174 EDSKEVIV-QLFETVREISGFPECRNTLKKQYCNLSRRVKLLSPLFEELKDGEGVLEEE 1 E SK V++ +L E +++ISG EC+N ++ Y NL RRVKLLSPLFEELKD + L +E Sbjct: 5 ESSKGVVLGRLVECIKDISGLLECQNFCRRVYGNLIRRVKLLSPLFEELKDSDESLSDE 63