BLASTX nr result
ID: Akebia23_contig00020244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00020244 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006448085.1| hypothetical protein CICLE_v10015905mg [Citr... 58 1e-06 ref|XP_006395841.1| hypothetical protein EUTSA_v10004555mg [Eutr... 58 1e-06 ref|XP_007222407.1| hypothetical protein PRUPE_ppa008147mg [Prun... 57 2e-06 gb|EXC05037.1| Purple acid phosphatase 3 [Morus notabilis] 57 3e-06 ref|XP_002285163.1| PREDICTED: purple acid phosphatase 3 isoform... 57 3e-06 ref|XP_002285160.1| PREDICTED: purple acid phosphatase 3 isoform... 57 3e-06 emb|CAN65461.1| hypothetical protein VITISV_002197 [Vitis vinifera] 57 3e-06 ref|XP_007222576.1| hypothetical protein PRUPE_ppa008436mg [Prun... 57 3e-06 ref|XP_004236915.1| PREDICTED: purple acid phosphatase 3-like [S... 56 5e-06 ref|XP_002890072.1| hypothetical protein ARALYDRAFT_471656 [Arab... 56 5e-06 ref|NP_001275216.1| purple acid phosphatase 1 precursor [Solanum... 56 5e-06 ref|XP_006291462.1| hypothetical protein CARUB_v10017599mg [Caps... 56 6e-06 gb|AAF19823.1|AF200827_1 putative purple acid phosphatase precur... 56 6e-06 ref|NP_973397.1| purple acid phosphatase 8 [Arabidopsis thaliana... 56 6e-06 ref|XP_002876783.1| hypothetical protein ARALYDRAFT_484107 [Arab... 56 6e-06 ref|NP_178298.2| purple acid phosphatase 8 [Arabidopsis thaliana... 56 6e-06 gb|AAD21785.1| putative purple acid phosphatase [Arabidopsis tha... 56 6e-06 gb|EXC05038.1| Purple acid phosphatase 3 [Morus notabilis] 55 8e-06 ref|XP_007045463.1| Purple acid phosphatase 3 isoform 2 [Theobro... 55 8e-06 ref|XP_007045462.1| Purple acid phosphatase 3 isoform 1 [Theobro... 55 8e-06 >ref|XP_006448085.1| hypothetical protein CICLE_v10015905mg [Citrus clementina] gi|568829995|ref|XP_006469300.1| PREDICTED: purple acid phosphatase 8-like [Citrus sinensis] gi|557550696|gb|ESR61325.1| hypothetical protein CICLE_v10015905mg [Citrus clementina] Length = 328 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVDSALKES AKWKIVVGHHTI+S+GHH Sbjct: 193 DVDSALKESTAKWKIVVGHHTIKSSGHH 220 >ref|XP_006395841.1| hypothetical protein EUTSA_v10004555mg [Eutrema salsugineum] gi|557092480|gb|ESQ33127.1| hypothetical protein EUTSA_v10004555mg [Eutrema salsugineum] Length = 334 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD AL+ESVAKWKIVVGHHTIRSAGHH Sbjct: 198 DVDVALQESVAKWKIVVGHHTIRSAGHH 225 >ref|XP_007222407.1| hypothetical protein PRUPE_ppa008147mg [Prunus persica] gi|462419343|gb|EMJ23606.1| hypothetical protein PRUPE_ppa008147mg [Prunus persica] Length = 343 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVDSALK+S AKWKIVVGHHTI+SAGHH Sbjct: 201 DVDSALKDSSAKWKIVVGHHTIKSAGHH 228 >gb|EXC05037.1| Purple acid phosphatase 3 [Morus notabilis] Length = 331 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVDSALK+S+AKWKIVVGHHTIRSAG H Sbjct: 196 DVDSALKDSIAKWKIVVGHHTIRSAGSH 223 >ref|XP_002285163.1| PREDICTED: purple acid phosphatase 3 isoform 2 [Vitis vinifera] Length = 296 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD+AL++S AKWKIVVGHHTIRSAGHH Sbjct: 161 DVDTALRDSTAKWKIVVGHHTIRSAGHH 188 >ref|XP_002285160.1| PREDICTED: purple acid phosphatase 3 isoform 1 [Vitis vinifera] gi|297737582|emb|CBI26783.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD+AL++S AKWKIVVGHHTIRSAGHH Sbjct: 189 DVDTALRDSTAKWKIVVGHHTIRSAGHH 216 >emb|CAN65461.1| hypothetical protein VITISV_002197 [Vitis vinifera] Length = 288 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD+AL++S AKWKIVVGHHTIRSAGHH Sbjct: 153 DVDTALRDSTAKWKIVVGHHTIRSAGHH 180 >ref|XP_007222576.1| hypothetical protein PRUPE_ppa008436mg [Prunus persica] gi|462419512|gb|EMJ23775.1| hypothetical protein PRUPE_ppa008436mg [Prunus persica] Length = 332 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 D+DSALKES AKWKIV+GHHTIRSAG+H Sbjct: 195 DLDSALKESTAKWKIVIGHHTIRSAGYH 222 >ref|XP_004236915.1| PREDICTED: purple acid phosphatase 3-like [Solanum lycopersicum] Length = 328 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 D+DSAL+ES AKWKIVVGHHTI+SAGHH Sbjct: 193 DLDSALRESSAKWKIVVGHHTIKSAGHH 220 >ref|XP_002890072.1| hypothetical protein ARALYDRAFT_471656 [Arabidopsis lyrata subsp. lyrata] gi|297335914|gb|EFH66331.1| hypothetical protein ARALYDRAFT_471656 [Arabidopsis lyrata subsp. lyrata] Length = 336 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 170 ETYYKFCE*DVDSALKESVAKWKIVVGHHTIRSAGHH 280 +TY +VD AL+ESVAKWKIV+GHHTI+SAGHH Sbjct: 189 QTYLNNLLKEVDVALRESVAKWKIVIGHHTIKSAGHH 225 >ref|NP_001275216.1| purple acid phosphatase 1 precursor [Solanum tuberosum] gi|47716659|gb|AAT37529.1| purple acid phosphatase 1 [Solanum tuberosum] Length = 328 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 D+DSAL+ES AKWKIVVGHHTI+SAGHH Sbjct: 193 DLDSALRESSAKWKIVVGHHTIKSAGHH 220 >ref|XP_006291462.1| hypothetical protein CARUB_v10017599mg [Capsella rubella] gi|482560169|gb|EOA24360.1| hypothetical protein CARUB_v10017599mg [Capsella rubella] Length = 334 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD AL+ES+AKWKIVVGHHTI+SAGHH Sbjct: 198 DVDVALQESMAKWKIVVGHHTIKSAGHH 225 >gb|AAF19823.1|AF200827_1 putative purple acid phosphatase precursor [Arabidopsis thaliana] Length = 314 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD AL+ES+AKWKIVVGHHTI+SAGHH Sbjct: 199 DVDVALQESMAKWKIVVGHHTIKSAGHH 226 >ref|NP_973397.1| purple acid phosphatase 8 [Arabidopsis thaliana] gi|330250419|gb|AEC05513.1| purple acid phosphatase 8 [Arabidopsis thaliana] Length = 307 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD AL+ES+AKWKIVVGHHTI+SAGHH Sbjct: 171 DVDVALQESMAKWKIVVGHHTIKSAGHH 198 >ref|XP_002876783.1| hypothetical protein ARALYDRAFT_484107 [Arabidopsis lyrata subsp. lyrata] gi|297322621|gb|EFH53042.1| hypothetical protein ARALYDRAFT_484107 [Arabidopsis lyrata subsp. lyrata] Length = 335 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD AL+ES+AKWKIVVGHHTI+SAGHH Sbjct: 199 DVDVALQESMAKWKIVVGHHTIKSAGHH 226 >ref|NP_178298.2| purple acid phosphatase 8 [Arabidopsis thaliana] gi|75248508|sp|Q8VYZ2.1|PPA8_ARATH RecName: Full=Purple acid phosphatase 8; Flags: Precursor gi|20257479|gb|AAM15909.1|AF492660_1 purple acid phosphatase [Arabidopsis thaliana] gi|17529296|gb|AAL38875.1| putative purple acid phosphatase [Arabidopsis thaliana] gi|21436121|gb|AAM51307.1| putative purple acid phosphatase [Arabidopsis thaliana] gi|330250418|gb|AEC05512.1| purple acid phosphatase 8 [Arabidopsis thaliana] Length = 335 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD AL+ES+AKWKIVVGHHTI+SAGHH Sbjct: 199 DVDVALQESMAKWKIVVGHHTIKSAGHH 226 >gb|AAD21785.1| putative purple acid phosphatase [Arabidopsis thaliana] Length = 351 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD AL+ES+AKWKIVVGHHTI+SAGHH Sbjct: 215 DVDVALQESMAKWKIVVGHHTIKSAGHH 242 >gb|EXC05038.1| Purple acid phosphatase 3 [Morus notabilis] Length = 339 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVDSALK S AKWKIVVGHH I+SAGHH Sbjct: 204 DVDSALKRSTAKWKIVVGHHAIKSAGHH 231 >ref|XP_007045463.1| Purple acid phosphatase 3 isoform 2 [Theobroma cacao] gi|508709398|gb|EOY01295.1| Purple acid phosphatase 3 isoform 2 [Theobroma cacao] Length = 360 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD+ALK+S AKWKIVVGHHTI+SAGHH Sbjct: 225 DVDAALKKSNAKWKIVVGHHTIKSAGHH 252 >ref|XP_007045462.1| Purple acid phosphatase 3 isoform 1 [Theobroma cacao] gi|508709397|gb|EOY01294.1| Purple acid phosphatase 3 isoform 1 [Theobroma cacao] Length = 334 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 197 DVDSALKESVAKWKIVVGHHTIRSAGHH 280 DVD+ALK+S AKWKIVVGHHTI+SAGHH Sbjct: 199 DVDAALKKSNAKWKIVVGHHTIKSAGHH 226