BLASTX nr result
ID: Akebia23_contig00020185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00020185 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003045352.1| hypothetical protein NECHADRAFT_44080 [Nectr... 56 5e-06 >ref|XP_003045352.1| hypothetical protein NECHADRAFT_44080 [Nectria haematococca mpVI 77-13-4] gi|256726277|gb|EEU39639.1| hypothetical protein NECHADRAFT_44080 [Nectria haematococca mpVI 77-13-4] Length = 384 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = -2 Query: 315 GKVPCPTDGAIFCVSETQFGMCDRGFAVPMAVAAGTKCQGDKIVV 181 G PCP G + C+S T FG+C+RG+A+P AV GTKC +IVV Sbjct: 338 GMEPCPVPGQLVCMSPTFFGLCNRGWALPQAVPKGTKCLDGQIVV 382