BLASTX nr result
ID: Akebia23_contig00020093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00020093 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293365.1| PREDICTED: tonoplast dicarboxylate transport... 74 3e-11 ref|XP_007211542.1| hypothetical protein PRUPE_ppa004013mg [Prun... 72 8e-11 gb|ADN52377.1| malate transporter [Malus domestica] 72 1e-10 gb|ADN52376.1| malate transporter [Malus domestica] 72 1e-10 gb|ADO51068.1| vacuolar malate transmembrane transporter [Malus ... 71 1e-10 ref|XP_003635625.1| PREDICTED: tonoplast dicarboxylate transport... 71 2e-10 emb|CBI25939.3| unnamed protein product [Vitis vinifera] 71 2e-10 emb|CBI33103.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_002277785.1| PREDICTED: tonoplast dicarboxylate transport... 71 2e-10 gb|EXB41592.1| Tonoplast dicarboxylate transporter [Morus notabi... 70 3e-10 ref|XP_002307886.1| hypothetical protein POPTR_0006s01490g [Popu... 69 7e-10 ref|XP_006352352.1| PREDICTED: tonoplast dicarboxylate transport... 69 9e-10 ref|XP_002531608.1| Tonoplast dicarboxylate transporter, putativ... 68 1e-09 gb|EYU27695.1| hypothetical protein MIMGU_mgv1a008425mg [Mimulus... 67 3e-09 ref|XP_004139542.1| PREDICTED: tonoplast dicarboxylate transport... 67 3e-09 ref|XP_006449875.1| hypothetical protein CICLE_v10014770mg [Citr... 67 3e-09 ref|NP_001275878.1| tonoplast dicarboxylate transporter-like [Ci... 67 3e-09 ref|NP_001266027.1| tonoplast dicarboxylate transporter-like [So... 66 6e-09 gb|ABD64997.1| sodium-dicarboxylate cotransporter, putative [Bra... 65 1e-08 ref|XP_006398454.1| hypothetical protein EUTSA_v10000848mg [Eutr... 64 2e-08 >ref|XP_004293365.1| PREDICTED: tonoplast dicarboxylate transporter-like [Fragaria vesca subsp. vesca] Length = 531 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 FTTGHI+IKDMIK GLPLKI G +TLLMPTLG +VF TNEPV Sbjct: 487 FTTGHIEIKDMIKVGLPLKIAGTAVLTLLMPTLGTYVFGTNEPV 530 >ref|XP_007211542.1| hypothetical protein PRUPE_ppa004013mg [Prunus persica] gi|462407407|gb|EMJ12741.1| hypothetical protein PRUPE_ppa004013mg [Prunus persica] Length = 535 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 FTTGHI+I+DMIKTGLPLKI G ++LLMPTLGA+VF TN PV Sbjct: 491 FTTGHIEIQDMIKTGLPLKIAGIAVLSLLMPTLGAYVFGTNGPV 534 >gb|ADN52377.1| malate transporter [Malus domestica] Length = 529 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 F TGHI+I+DMIK GLPLKIVG ++LLMPTLGA+VF+T+EPV Sbjct: 486 FATGHIEIQDMIKIGLPLKIVGIAVLSLLMPTLGAYVFKTSEPV 529 >gb|ADN52376.1| malate transporter [Malus domestica] Length = 529 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 F TGHI+I+DMIK GLPLKIVG ++LLMPTLGA+VF+T+EPV Sbjct: 486 FATGHIEIQDMIKIGLPLKIVGIAVLSLLMPTLGAYVFKTSEPV 529 >gb|ADO51068.1| vacuolar malate transmembrane transporter [Malus domestica] Length = 387 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEP 130 FTTGHI+I+DMIKTGLPLKI G ++LLMPTLGA+VF TNEP Sbjct: 342 FTTGHIEIQDMIKTGLPLKIAGTVVLSLLMPTLGAYVFGTNEP 384 >ref|XP_003635625.1| PREDICTED: tonoplast dicarboxylate transporter-like, partial [Vitis vinifera] Length = 433 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNE 127 FTTGHI+IKDMIKTG+PLKI G A++LLMP+LGA+VF TNE Sbjct: 390 FTTGHIEIKDMIKTGVPLKIAGIAALSLLMPSLGAYVFGTNE 431 >emb|CBI25939.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNE 127 FTTGHI+IKDMIKTG+PLKI G A++LLMP+LGA+VF TNE Sbjct: 392 FTTGHIEIKDMIKTGVPLKIAGIAALSLLMPSLGAYVFGTNE 433 >emb|CBI33103.3| unnamed protein product [Vitis vinifera] Length = 462 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNE 127 FTTGHI+IKDMIKTG+PLKI G A++LLMP+LGA+VF TNE Sbjct: 419 FTTGHIEIKDMIKTGVPLKIAGIAALSLLMPSLGAYVFGTNE 460 >ref|XP_002277785.1| PREDICTED: tonoplast dicarboxylate transporter-like [Vitis vinifera] Length = 531 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNE 127 FTTGHI+IKDMIKTG+PLKI G A++LLMP+LGA+VF TNE Sbjct: 488 FTTGHIEIKDMIKTGVPLKIAGIAALSLLMPSLGAYVFGTNE 529 >gb|EXB41592.1| Tonoplast dicarboxylate transporter [Morus notabilis] Length = 533 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEP 130 F TGHI+I+DMIKTG PLKI G A++LLMPTLGA+VF TNEP Sbjct: 488 FATGHIEIRDMIKTGGPLKIAGIAALSLLMPTLGAYVFGTNEP 530 >ref|XP_002307886.1| hypothetical protein POPTR_0006s01490g [Populus trichocarpa] gi|222853862|gb|EEE91409.1| hypothetical protein POPTR_0006s01490g [Populus trichocarpa] Length = 462 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 F+TGHI+IKDMIKTG+PLKI G A++LLMPTLGA+VF TN V Sbjct: 419 FSTGHIEIKDMIKTGVPLKIFGIAALSLLMPTLGAYVFGTNGEV 462 >ref|XP_006352352.1| PREDICTED: tonoplast dicarboxylate transporter-like [Solanum tuberosum] Length = 551 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 FTTGHI+IKDMIKTGLPLKI G A++ LMPTLG VF T++PV Sbjct: 496 FTTGHIEIKDMIKTGLPLKIAGIVALSFLMPTLGPMVFGTDKPV 539 >ref|XP_002531608.1| Tonoplast dicarboxylate transporter, putative [Ricinus communis] gi|223528775|gb|EEF30783.1| Tonoplast dicarboxylate transporter, putative [Ricinus communis] Length = 535 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTN 124 FTTGHI+IKDMIKTG+PLKI G A++ +MPTLGA+VF TN Sbjct: 489 FTTGHIEIKDMIKTGVPLKIAGIAALSFIMPTLGAYVFGTN 529 >gb|EYU27695.1| hypothetical protein MIMGU_mgv1a008425mg [Mimulus guttatus] Length = 374 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 FTTGHI+I DM+ TG PLKI G +++LMPTLGAFVFRT+EP+ Sbjct: 326 FTTGHIEINDMLITGAPLKIAGILVLSILMPTLGAFVFRTDEPL 369 >ref|XP_004139542.1| PREDICTED: tonoplast dicarboxylate transporter-like [Cucumis sativus] gi|449513611|ref|XP_004164371.1| PREDICTED: tonoplast dicarboxylate transporter-like [Cucumis sativus] Length = 538 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 F+TG+IDI DMIK GLPLKIVG A++LLMP+LG+ VF TN+P+ Sbjct: 494 FSTGYIDIPDMIKIGLPLKIVGIAAVSLLMPSLGSLVFETNKPM 537 >ref|XP_006449875.1| hypothetical protein CICLE_v10014770mg [Citrus clementina] gi|557552486|gb|ESR63115.1| hypothetical protein CICLE_v10014770mg [Citrus clementina] Length = 562 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 FTTGHI+I+DMIKTGLPLKI G A+ LMPTLGA+VF T+ V Sbjct: 518 FTTGHIEIQDMIKTGLPLKIAGIAALAFLMPTLGAYVFGTDVDV 561 >ref|NP_001275878.1| tonoplast dicarboxylate transporter-like [Citrus sinensis] gi|116804319|gb|ABK27327.1| vacuolar citrate/H+ symporter [Citrus sinensis] Length = 533 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 FTTGHI+I+DMIKTGLPLKI G A+ LMPTLGA+VF T+ V Sbjct: 489 FTTGHIEIQDMIKTGLPLKIAGIAALAFLMPTLGAYVFGTDGDV 532 >ref|NP_001266027.1| tonoplast dicarboxylate transporter-like [Solanum lycopersicum] gi|511515066|gb|AGN75053.1| vacuolar malate transmembrane transporter [Solanum lycopersicum] Length = 552 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRTNEPV 133 FTTGHI+IKDMIKTGLPLKI G A++ LMPTLG VF T++ V Sbjct: 497 FTTGHIEIKDMIKTGLPLKIAGIVALSFLMPTLGPMVFETDKRV 540 >gb|ABD64997.1| sodium-dicarboxylate cotransporter, putative [Brassica oleracea] Length = 527 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVFRT 121 FTTGHI+IKDMIKTGLPLKI G +++LMPTLGA+VF T Sbjct: 486 FTTGHIEIKDMIKTGLPLKIAGTAFLSVLMPTLGAYVFGT 525 >ref|XP_006398454.1| hypothetical protein EUTSA_v10000848mg [Eutrema salsugineum] gi|557099543|gb|ESQ39907.1| hypothetical protein EUTSA_v10000848mg [Eutrema salsugineum] Length = 539 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 2 FTTGHIDIKDMIKTGLPLKIVGFGAITLLMPTLGAFVF 115 FTTGHI+IKDMIKTGLPLKI G +++LMPTLGA+VF Sbjct: 496 FTTGHIEIKDMIKTGLPLKIAGTAFLSVLMPTLGAYVF 533