BLASTX nr result
ID: Akebia23_contig00018098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00018098 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007143939.1| hypothetical protein PHAVU_007G115200g [Phas... 56 6e-06 ref|XP_003622376.1| hypothetical protein MTR_7g035190 [Medicago ... 55 8e-06 >ref|XP_007143939.1| hypothetical protein PHAVU_007G115200g [Phaseolus vulgaris] gi|561017129|gb|ESW15933.1| hypothetical protein PHAVU_007G115200g [Phaseolus vulgaris] Length = 749 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 485 AILAIKREGYSIKCIGPRGVVVTEKFLPSTTVSI 384 A LAIKREGYSIKC GP GV++TEKF PST V+I Sbjct: 655 ATLAIKREGYSIKCSGPNGVLITEKFSPSTQVAI 688 >ref|XP_003622376.1| hypothetical protein MTR_7g035190 [Medicago truncatula] gi|355497391|gb|AES78594.1| hypothetical protein MTR_7g035190 [Medicago truncatula] Length = 747 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 485 AILAIKREGYSIKCIGPRGVVVTEKFLPSTTVSI 384 A LAIK+EGYSIKC GP GVV+TEKF PST V I Sbjct: 652 ATLAIKKEGYSIKCSGPNGVVITEKFSPSTNVMI 685