BLASTX nr result
ID: Akebia23_contig00013732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00013732 (610 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433095.1| hypothetical protein CICLE_v10001604mg [Citr... 61 3e-07 >ref|XP_006433095.1| hypothetical protein CICLE_v10001604mg [Citrus clementina] gi|557535217|gb|ESR46335.1| hypothetical protein CICLE_v10001604mg [Citrus clementina] Length = 363 Score = 60.8 bits (146), Expect = 3e-07 Identities = 45/143 (31%), Positives = 62/143 (43%), Gaps = 23/143 (16%) Frame = +3 Query: 3 LLSSIRWHHKPNSNSHGGHIDNGTNRLNGS----SGNTLHDPNF-----------NGNQ- 134 LLS W P+S H GH N G S H P+ NG++ Sbjct: 190 LLSPSVWRRSPDSTGHHGHGPGNGNTGYGDYSDKSSKDGHKPSVRNGDYDNYYHNNGSRT 249 Query: 135 EPTMISTGGWTRPSRLGWATP-----LNPANNTGIANENLKDATKSTSNSMDPKRQFN-- 293 EPT+ ++GGWTRP+R GW P +P N+ A L++ + TS + P+ + Sbjct: 250 EPTVTNSGGWTRPTRAGWGVPPDASLSSPTNDINTAVRYLQEGARPTSVTTAPQSRVTVP 309 Query: 294 XXXXXXXXXXXXIIDSREAARKY 362 IDSREAAR+Y Sbjct: 310 ITTGPRRDDYGQTIDSREAARRY 332