BLASTX nr result
ID: Akebia23_contig00012439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00012439 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211614.1| hypothetical protein PRUPE_ppa005510mg [Prun... 98 1e-18 ref|XP_007211613.1| hypothetical protein PRUPE_ppa005510mg [Prun... 98 1e-18 ref|XP_007211612.1| hypothetical protein PRUPE_ppa005510mg [Prun... 98 1e-18 ref|XP_006360660.1| PREDICTED: protein ECERIFERUM 7-like [Solanu... 97 2e-18 ref|XP_004240124.1| PREDICTED: exosome complex component rrp45-l... 96 7e-18 ref|XP_002270464.1| PREDICTED: exosome complex component rrp45-l... 95 1e-17 ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-l... 94 2e-17 ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-l... 94 2e-17 ref|XP_004288603.1| PREDICTED: exosome complex component rrp45-l... 92 7e-17 gb|EXB93334.1| Exosome complex component rrp45 [Morus notabilis] 91 2e-16 ref|XP_006858247.1| hypothetical protein AMTR_s00062p00201720 [A... 91 2e-16 ref|XP_004497542.1| PREDICTED: exosome complex component RRP45-l... 91 2e-16 ref|XP_004497540.1| PREDICTED: exosome complex component RRP45-l... 91 2e-16 ref|XP_006590472.1| PREDICTED: protein ECERIFERUM 7-like isoform... 90 3e-16 ref|XP_006590471.1| PREDICTED: protein ECERIFERUM 7-like isoform... 90 3e-16 ref|XP_003593906.1| Exosome complex exonuclease RRP45 [Medicago ... 90 3e-16 ref|XP_006379052.1| hypothetical protein POPTR_0009s05220g [Popu... 90 4e-16 ref|XP_006470651.1| PREDICTED: protein ECERIFERUM 7-like isoform... 89 6e-16 ref|XP_006446171.1| hypothetical protein CICLE_v10015158mg [Citr... 89 8e-16 gb|EPS73851.1| hypothetical protein M569_00914 [Genlisea aurea] 87 2e-15 >ref|XP_007211614.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] gi|462407479|gb|EMJ12813.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] Length = 457 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/52 (82%), Positives = 51/52 (98%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLANTWRM++NEKKFIETALLSDLR+DGRRPFDYR LT+KFG+++GS+E Sbjct: 1 MEQRLANTWRMSVNEKKFIETALLSDLRIDGRRPFDYRNLTIKFGKDEGSAE 52 >ref|XP_007211613.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] gi|462407478|gb|EMJ12812.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] Length = 385 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/52 (82%), Positives = 51/52 (98%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLANTWRM++NEKKFIETALLSDLR+DGRRPFDYR LT+KFG+++GS+E Sbjct: 1 MEQRLANTWRMSVNEKKFIETALLSDLRIDGRRPFDYRNLTIKFGKDEGSAE 52 >ref|XP_007211612.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] gi|462407477|gb|EMJ12811.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] Length = 369 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/52 (82%), Positives = 51/52 (98%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLANTWRM++NEKKFIETALLSDLR+DGRRPFDYR LT+KFG+++GS+E Sbjct: 1 MEQRLANTWRMSVNEKKFIETALLSDLRIDGRRPFDYRNLTIKFGKDEGSAE 52 >ref|XP_006360660.1| PREDICTED: protein ECERIFERUM 7-like [Solanum tuberosum] Length = 443 Score = 97.4 bits (241), Expect = 2e-18 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRL NTWRMT+NEKKFIE+AL S+LRVDGRRPFDYR LT+KFGREDGSSE Sbjct: 1 MEQRLGNTWRMTVNEKKFIESALESELRVDGRRPFDYRALTIKFGREDGSSE 52 >ref|XP_004240124.1| PREDICTED: exosome complex component rrp45-like [Solanum lycopersicum] Length = 443 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRL +TWRMT+NEKKFIE+AL S+LRVDGRRPFDYR LT+KFGREDGSSE Sbjct: 1 MEQRLGSTWRMTVNEKKFIESALESELRVDGRRPFDYRALTIKFGREDGSSE 52 >ref|XP_002270464.1| PREDICTED: exosome complex component rrp45-like [Vitis vinifera] Length = 467 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/52 (82%), Positives = 51/52 (98%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLA+T+RMT+NEKKFIE ALLSDLR+DGRRPFD+RR+++KFGREDGSSE Sbjct: 1 MEQRLASTFRMTVNEKKFIEKALLSDLRIDGRRPFDFRRISIKFGREDGSSE 52 >ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 454 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLANTWR++ NEKKFIETALLSDLRVDGR PFDYR LT+ FG++DGSSE Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRGPFDYRNLTINFGKDDGSSE 52 >ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 452 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLANTWR++ NEKKFIETALLSDLRVDGR PFDYR LT+ FG++DGSSE Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRGPFDYRNLTINFGKDDGSSE 52 >ref|XP_004288603.1| PREDICTED: exosome complex component rrp45-like [Fragaria vesca subsp. vesca] Length = 465 Score = 92.0 bits (227), Expect = 7e-17 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLANTWRMT+NEKKFIETAL S LR+DGRRPFDYR + +KFG++DGS+E Sbjct: 1 MEQRLANTWRMTVNEKKFIETALESGLRIDGRRPFDYRTVDIKFGKDDGSAE 52 >gb|EXB93334.1| Exosome complex component rrp45 [Morus notabilis] Length = 451 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLAN+WR+T+NEKKFIETALL LR+DGRRPFDYR LT+ FG+ DGS E Sbjct: 1 MEQRLANSWRLTVNEKKFIETALLPALRIDGRRPFDYRNLTINFGKHDGSGE 52 >ref|XP_006858247.1| hypothetical protein AMTR_s00062p00201720 [Amborella trichopoda] gi|548862350|gb|ERN19714.1| hypothetical protein AMTR_s00062p00201720 [Amborella trichopoda] Length = 421 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLAN WRM++NEKKFIE ALLSD RVDGRRPFDYRRL++KFG +DG++E Sbjct: 1 MEQRLANIWRMSVNEKKFIENALLSDHRVDGRRPFDYRRLSLKFGSDDGTAE 52 >ref|XP_004497542.1| PREDICTED: exosome complex component RRP45-like isoform X3 [Cicer arietinum] Length = 449 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLAN WR+T+NEKKFIE+ALLSDLRVDGR P DYR+L +KFG++DGS+E Sbjct: 1 MEQRLANCWRLTVNEKKFIESALLSDLRVDGRGPLDYRKLNIKFGKDDGSAE 52 >ref|XP_004497540.1| PREDICTED: exosome complex component RRP45-like isoform X1 [Cicer arietinum] gi|502122023|ref|XP_004497541.1| PREDICTED: exosome complex component RRP45-like isoform X2 [Cicer arietinum] Length = 450 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLAN WR+T+NEKKFIE+ALLSDLRVDGR P DYR+L +KFG++DGS+E Sbjct: 1 MEQRLANCWRLTVNEKKFIESALLSDLRVDGRGPLDYRKLNIKFGKDDGSAE 52 >ref|XP_006590472.1| PREDICTED: protein ECERIFERUM 7-like isoform X2 [Glycine max] Length = 357 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLANTWRM +N+KKFIETALLSDLR+DGRRP DYR+LTVK ++DGS+E Sbjct: 1 MEQRLANTWRMPLNDKKFIETALLSDLRLDGRRPSDYRKLTVKLAKQDGSAE 52 >ref|XP_006590471.1| PREDICTED: protein ECERIFERUM 7-like isoform X1 [Glycine max] Length = 438 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLANTWRM +N+KKFIETALLSDLR+DGRRP DYR+LTVK ++DGS+E Sbjct: 1 MEQRLANTWRMPLNDKKFIETALLSDLRLDGRRPSDYRKLTVKLAKQDGSAE 52 >ref|XP_003593906.1| Exosome complex exonuclease RRP45 [Medicago truncatula] gi|355482954|gb|AES64157.1| Exosome complex exonuclease RRP45 [Medicago truncatula] Length = 449 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/52 (76%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLAN WR+T+NEKKFIE+ALLS+LRVDGR P DYR+L +KFGR+DGS+E Sbjct: 1 MEQRLANCWRLTVNEKKFIESALLSELRVDGRGPLDYRKLNIKFGRDDGSAE 52 >ref|XP_006379052.1| hypothetical protein POPTR_0009s05220g [Populus trichocarpa] gi|550331070|gb|ERP56849.1| hypothetical protein POPTR_0009s05220g [Populus trichocarpa] Length = 464 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/52 (75%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 M+ RLANTWR+T+NEKKFIETAL S+LR+DGR P +YR++T+KFGREDGSSE Sbjct: 1 MDGRLANTWRLTLNEKKFIETALASNLRIDGRNPLEYRKITIKFGREDGSSE 52 >ref|XP_006470651.1| PREDICTED: protein ECERIFERUM 7-like isoform X1 [Citrus sinensis] gi|568832879|ref|XP_006470652.1| PREDICTED: protein ECERIFERUM 7-like isoform X2 [Citrus sinensis] gi|568832881|ref|XP_006470653.1| PREDICTED: protein ECERIFERUM 7-like isoform X3 [Citrus sinensis] gi|568832883|ref|XP_006470654.1| PREDICTED: protein ECERIFERUM 7-like isoform X4 [Citrus sinensis] gi|568832885|ref|XP_006470655.1| PREDICTED: protein ECERIFERUM 7-like isoform X5 [Citrus sinensis] Length = 465 Score = 89.0 bits (219), Expect = 6e-16 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 M+ RLANTWR+T+NEK+FIETAL S +R+DGR PF+YR+L++KFGREDGSSE Sbjct: 1 MDTRLANTWRLTVNEKRFIETALSSGIRIDGRNPFEYRKLSIKFGREDGSSE 52 >ref|XP_006446171.1| hypothetical protein CICLE_v10015158mg [Citrus clementina] gi|567907717|ref|XP_006446172.1| hypothetical protein CICLE_v10015158mg [Citrus clementina] gi|567907719|ref|XP_006446173.1| hypothetical protein CICLE_v10015158mg [Citrus clementina] gi|557548782|gb|ESR59411.1| hypothetical protein CICLE_v10015158mg [Citrus clementina] gi|557548783|gb|ESR59412.1| hypothetical protein CICLE_v10015158mg [Citrus clementina] gi|557548784|gb|ESR59413.1| hypothetical protein CICLE_v10015158mg [Citrus clementina] Length = 464 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/52 (73%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 M+ RLANTWR+T+NEK+FIETAL S +R+DGR PF+YR+L++KFGREDGSSE Sbjct: 1 MDARLANTWRLTVNEKRFIETALNSGIRIDGRNPFEYRKLSIKFGREDGSSE 52 >gb|EPS73851.1| hypothetical protein M569_00914 [Genlisea aurea] Length = 439 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = -2 Query: 157 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRPFDYRRLTVKFGREDGSSE 2 MEQRLA++ R+T+NEKKFIETALLSDLR+DGR PFDYR LT++FG EDGSSE Sbjct: 1 MEQRLASSRRVTVNEKKFIETALLSDLRIDGRGPFDYRNLTIQFGCEDGSSE 52