BLASTX nr result
ID: Akebia23_contig00012401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00012401 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268993.1| PREDICTED: NEDD8 ultimate buster 1 [Vitis vi... 69 7e-10 ref|XP_002532310.1| NEDD8 ultimate buster, putative [Ricinus com... 69 9e-10 ref|XP_007013627.1| Ubiquitin-associated (UBA)/TS-N domain-conta... 67 2e-09 ref|XP_002527272.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_006453132.1| hypothetical protein CICLE_v10007887mg [Citr... 65 1e-08 ref|XP_006389398.1| hypothetical protein POPTR_0025s00350g [Popu... 64 2e-08 ref|XP_006381076.1| ubiquitin-associated domain-containing famil... 61 1e-07 ref|XP_006381075.1| hypothetical protein POPTR_0006s06020g [Popu... 61 1e-07 ref|XP_004287245.1| PREDICTED: NEDD8 ultimate buster 1-like [Fra... 61 1e-07 ref|XP_003579376.1| PREDICTED: uncharacterized protein LOC100829... 61 2e-07 gb|EYU38315.1| hypothetical protein MIMGU_mgv1a003960mg [Mimulus... 60 4e-07 ref|XP_004977015.1| PREDICTED: NEDD8 ultimate buster 1-like [Set... 59 5e-07 ref|XP_006359510.1| PREDICTED: NEDD8 ultimate buster 1-like [Sol... 59 9e-07 ref|XP_004488510.1| PREDICTED: NEDD8 ultimate buster 1-like [Cic... 59 9e-07 gb|EMT19509.1| hypothetical protein F775_04118 [Aegilops tauschii] 59 9e-07 gb|EMS52583.1| hypothetical protein TRIUR3_06846 [Triticum urartu] 59 9e-07 ref|XP_007201940.1| hypothetical protein PRUPE_ppa004340mg [Prun... 59 9e-07 ref|XP_001781827.1| predicted protein [Physcomitrella patens] gi... 59 9e-07 ref|XP_004294681.1| PREDICTED: NEDD8 ultimate buster 1-like [Fra... 58 1e-06 ref|XP_004242723.1| PREDICTED: NEDD8 ultimate buster 1-like [Sol... 58 1e-06 >ref|XP_002268993.1| PREDICTED: NEDD8 ultimate buster 1 [Vitis vinifera] gi|296084548|emb|CBI25569.3| unnamed protein product [Vitis vinifera] Length = 552 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/52 (69%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = -2 Query: 423 SSSINKKEERDVEMEQAIAEEL-TGDVLSDYDIEVTKEGEAITEYLVLLASS 271 SSS K EERD+EME +AE+L GD SDYD+EVTKEGEAI EYL LLAS+ Sbjct: 491 SSSAKKGEERDLEMEDELAEDLRNGDAFSDYDMEVTKEGEAINEYLTLLASA 542 >ref|XP_002532310.1| NEDD8 ultimate buster, putative [Ricinus communis] gi|223527979|gb|EEF30062.1| NEDD8 ultimate buster, putative [Ricinus communis] Length = 559 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/59 (61%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = -2 Query: 432 DQASSSINKKEERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLLASSTSNN 259 D S ++ E+RD+EME IAEE+ GD LSDYDIEVTKEGEAI EY+ LL S S+N Sbjct: 495 DTEGPSASEVEQRDLEMEDTIAEEIAKGDALSDYDIEVTKEGEAINEYMALLNSVDSSN 553 >ref|XP_007013627.1| Ubiquitin-associated (UBA)/TS-N domain-containing protein [Theobroma cacao] gi|508783990|gb|EOY31246.1| Ubiquitin-associated (UBA)/TS-N domain-containing protein [Theobroma cacao] Length = 464 Score = 67.4 bits (163), Expect = 2e-09 Identities = 38/56 (67%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -2 Query: 405 KEERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLLASSTSNN*KVLSA 241 +EERDVEME IA+E+ D LSDYDIE+TKEGEAI EYL LLA ST N K LS+ Sbjct: 410 EEERDVEMEDEIAKEIEIADALSDYDIEITKEGEAINEYLALLA-STDNGNKALSS 464 >ref|XP_002527272.1| conserved hypothetical protein [Ricinus communis] gi|223533365|gb|EEF35116.1| conserved hypothetical protein [Ricinus communis] Length = 80 Score = 65.1 bits (157), Expect = 1e-08 Identities = 37/59 (62%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -2 Query: 435 ADQASSSINKKEERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLLASSTSN 262 A +S S EERDVEME IAE++ D LSDYDI+VTKEGEAITEYL LL S S+ Sbjct: 15 APNSSPSGISTEERDVEMEDEIAEQIAKADALSDYDIDVTKEGEAITEYLALLDSVRSS 73 >ref|XP_006453132.1| hypothetical protein CICLE_v10007887mg [Citrus clementina] gi|568840834|ref|XP_006474370.1| PREDICTED: NEDD8 ultimate buster 1-like [Citrus sinensis] gi|557556358|gb|ESR66372.1| hypothetical protein CICLE_v10007887mg [Citrus clementina] Length = 561 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -2 Query: 429 QASSSINKKEERDVEMEQAIAEELTGDVLSDYDIEVTKEGEAITEYLVLLAS 274 + +S+ RDVEME +A +LTGDV +DYDIEVTKEGEAI+EYL LL S Sbjct: 499 EETSATEDVNGRDVEMEDELANDLTGDVFADYDIEVTKEGEAISEYLSLLES 550 >ref|XP_006389398.1| hypothetical protein POPTR_0025s00350g [Populus trichocarpa] gi|550312192|gb|ERP48312.1| hypothetical protein POPTR_0025s00350g [Populus trichocarpa] Length = 578 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/44 (77%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -2 Query: 402 EERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLLAS 274 E+RDVEME IA+EL GD LSDYDIEV KEGEAI EYL LLAS Sbjct: 524 EQRDVEMEGEIADELARGDALSDYDIEVAKEGEAINEYLALLAS 567 >ref|XP_006381076.1| ubiquitin-associated domain-containing family protein [Populus trichocarpa] gi|550335581|gb|ERP58873.1| ubiquitin-associated domain-containing family protein [Populus trichocarpa] Length = 585 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/56 (60%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -2 Query: 402 EERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLLASSTSNN*KVLSAQ 238 E+RD+EME IA+ELT GD LSDY+I+VT+EG+AI EYL LL S N K S+Q Sbjct: 528 EQRDLEMEDEIADELTRGDALSDYNIDVTQEGDAINEYLALLDSGGGNG-KASSSQ 582 >ref|XP_006381075.1| hypothetical protein POPTR_0006s06020g [Populus trichocarpa] gi|550335580|gb|ERP58872.1| hypothetical protein POPTR_0006s06020g [Populus trichocarpa] Length = 585 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/56 (60%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -2 Query: 402 EERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLLASSTSNN*KVLSAQ 238 E+RD+EME IA+ELT GD LSDY+I+VT+EG+AI EYL LL S N K S+Q Sbjct: 528 EQRDLEMEDEIADELTRGDALSDYNIDVTQEGDAINEYLALLDSGGGNG-KASSSQ 582 >ref|XP_004287245.1| PREDICTED: NEDD8 ultimate buster 1-like [Fragaria vesca subsp. vesca] Length = 560 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -2 Query: 420 SSINKKEERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLLASS 271 S+ ERD EME +AEEL GD +DYDIEVTKEGEAI+EYL LL S+ Sbjct: 507 STSTNASERDAEMESELAEELAQGDAFTDYDIEVTKEGEAISEYLALLNSA 557 >ref|XP_003579376.1| PREDICTED: uncharacterized protein LOC100829250 [Brachypodium distachyon] Length = 577 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/60 (51%), Positives = 42/60 (70%) Frame = -2 Query: 438 QADQASSSINKKEERDVEMEQAIAEELTGDVLSDYDIEVTKEGEAITEYLVLLASSTSNN 259 + +QA+S N+ RDV ME +A ELTGD L DYDI+V EG+AITEYL LL + +++ Sbjct: 519 EGEQAASH-NQPPARDVVMENELANELTGDALDDYDIDVANEGQAITEYLSLLEPAAASS 577 >gb|EYU38315.1| hypothetical protein MIMGU_mgv1a003960mg [Mimulus guttatus] Length = 552 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -2 Query: 399 ERDVEMEQAIAEEL-TGDVLSDYDIEVTKEGEAITEYLVLLASSTSNN 259 ERDVEME+ + EEL D SDYDIEV KEGEAI YL LL S+ +NN Sbjct: 504 ERDVEMEEELTEELQNADAYSDYDIEVIKEGEAIAHYLALLNSADNNN 551 >ref|XP_004977015.1| PREDICTED: NEDD8 ultimate buster 1-like [Setaria italica] Length = 621 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 38/57 (66%) Frame = -2 Query: 432 DQASSSINKKEERDVEMEQAIAEELTGDVLSDYDIEVTKEGEAITEYLVLLASSTSN 262 D ++ + RDV ME +A +LTGD L DYDIEV+ EG+AI EYL LL S+ S+ Sbjct: 565 DDEDTNSHPVPARDVSMESELAHDLTGDALDDYDIEVSDEGQAIAEYLSLLESAASS 621 >ref|XP_006359510.1| PREDICTED: NEDD8 ultimate buster 1-like [Solanum tuberosum] Length = 570 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/47 (68%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -2 Query: 417 SINKKEERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLL 280 S NK E RDVEME I EL GD SDYDIEVT+EGEAI EYL L+ Sbjct: 512 SHNKVETRDVEMEDEITGELLKGDAYSDYDIEVTEEGEAINEYLALI 558 >ref|XP_004488510.1| PREDICTED: NEDD8 ultimate buster 1-like [Cicer arietinum] Length = 557 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/49 (61%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = -2 Query: 408 KKEERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLLASSTS 265 K EERDVEME ++ ++ GD L+DYDIEVT EGEAITEYL ++ S+ S Sbjct: 501 KAEERDVEMEDELSADIAKGDALTDYDIEVTIEGEAITEYLSMVESAGS 549 >gb|EMT19509.1| hypothetical protein F775_04118 [Aegilops tauschii] Length = 146 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -2 Query: 432 DQASSSINKKEERDVEMEQAIAEELTGDVLSDYDIEVTKEGEAITEYLVLLASSTS 265 ++A +S + RDV ME +A ELTGD L DYDI+V EG+AI EYL LL S+ + Sbjct: 86 EEAGASHAQGPVRDVAMENELANELTGDALDDYDIDVANEGQAIAEYLSLLESAAA 141 >gb|EMS52583.1| hypothetical protein TRIUR3_06846 [Triticum urartu] Length = 213 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -2 Query: 432 DQASSSINKKEERDVEMEQAIAEELTGDVLSDYDIEVTKEGEAITEYLVLLASSTS 265 ++A +S + RDV ME +A ELTGD L DYDI+V EG+AI EYL LL S+ + Sbjct: 152 EEAGASHAQGPVRDVAMENELANELTGDALDDYDIDVANEGQAIAEYLSLLESAAA 207 >ref|XP_007201940.1| hypothetical protein PRUPE_ppa004340mg [Prunus persica] gi|462397471|gb|EMJ03139.1| hypothetical protein PRUPE_ppa004340mg [Prunus persica] Length = 515 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -2 Query: 420 SSINKKEERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLLASS 271 S+ + +RD EME +A EL GD LSDYD+EVTKEGEAI EYL LL S+ Sbjct: 463 STAGEVGDRDAEMEDELAGELAQGDALSDYDLEVTKEGEAINEYLALLDSA 513 >ref|XP_001781827.1| predicted protein [Physcomitrella patens] gi|162666734|gb|EDQ53381.1| predicted protein [Physcomitrella patens] Length = 571 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -2 Query: 402 EERDVEMEQAIAEELTGDVLSDYDIEVTKEGEAITEYLVLLASS 271 + RD EME+ IA E+TGD ++YDIEV+KEG+AI+EYL LL S+ Sbjct: 522 DPRDEEMEEEIAREITGDPFAEYDIEVSKEGDAISEYLALLNSN 565 >ref|XP_004294681.1| PREDICTED: NEDD8 ultimate buster 1-like [Fragaria vesca subsp. vesca] Length = 564 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/48 (64%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -2 Query: 411 NKKEERDVEMEQAIAEELTG-DVLSDYDIEVTKEGEAITEYLVLLASS 271 ++ ERD EME +AEEL D LSDYD+EVTKEGEAI EYL LL S+ Sbjct: 516 SRASERDSEMENELAEELAQQDALSDYDLEVTKEGEAIGEYLALLDSA 563 >ref|XP_004242723.1| PREDICTED: NEDD8 ultimate buster 1-like [Solanum lycopersicum] Length = 570 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/47 (68%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -2 Query: 417 SINKKEERDVEMEQAIAEELT-GDVLSDYDIEVTKEGEAITEYLVLL 280 S NK E RDVEME I EL GD SDYDIEVT+EGEAI EYL L+ Sbjct: 512 SQNKVETRDVEMEDEITGELLKGDAYSDYDIEVTEEGEAINEYLALV 558