BLASTX nr result
ID: Akebia23_contig00012300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00012300 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489759.1| PREDICTED: peptide transporter PTR3-A-like [... 70 3e-10 ref|XP_006420301.1| hypothetical protein CICLE_v10004592mg [Citr... 70 3e-10 ref|XP_006489758.1| PREDICTED: peptide transporter PTR3-A-like [... 70 4e-10 ref|XP_006472979.1| PREDICTED: peptide transporter PTR3-A-like [... 69 9e-10 ref|XP_007035207.1| Peptide transporter PTR3-A [Theobroma cacao]... 69 9e-10 ref|XP_006433551.1| hypothetical protein CICLE_v10003924mg [Citr... 68 1e-09 ref|XP_006420305.1| hypothetical protein CICLE_v10004600mg [Citr... 68 1e-09 ref|XP_006420304.1| hypothetical protein CICLE_v10004600mg [Citr... 68 1e-09 ref|XP_006420303.1| hypothetical protein CICLE_v10004600mg [Citr... 68 1e-09 ref|XP_006489657.1| PREDICTED: peptide transporter PTR3-A-like [... 67 2e-09 ref|XP_006420320.1| hypothetical protein CICLE_v10006425mg [Citr... 66 4e-09 ref|XP_002311689.2| proton-dependent oligopeptide transport fami... 66 4e-09 ref|XP_002314492.1| proton-dependent oligopeptide transport fami... 66 6e-09 gb|AAL36413.1| putative peptide transporter protein [Arabidopsis... 66 6e-09 ref|NP_199417.1| peptide transporter 3 [Arabidopsis thaliana] gi... 65 8e-09 ref|XP_002863431.1| hypothetical protein ARALYDRAFT_494374 [Arab... 65 8e-09 ref|XP_007222061.1| hypothetical protein PRUPE_ppa003209mg [Prun... 65 1e-08 ref|XP_004247558.1| PREDICTED: peptide transporter PTR3-A-like [... 65 1e-08 ref|XP_003556370.1| PREDICTED: peptide transporter PTR3-A-like [... 64 2e-08 ref|XP_003625335.1| Peptide transporter PTR3-A [Medicago truncat... 64 2e-08 >ref|XP_006489759.1| PREDICTED: peptide transporter PTR3-A-like [Citrus sinensis] Length = 509 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VSDITK+ KGWILNNLNVS LDYYY F+A+L +LNF+FF V F Sbjct: 422 VSDITKRHGHKGWILNNLNVSHLDYYYAFFAILNVLNFVFFLVVAKF 468 >ref|XP_006420301.1| hypothetical protein CICLE_v10004592mg [Citrus clementina] gi|557522174|gb|ESR33541.1| hypothetical protein CICLE_v10004592mg [Citrus clementina] Length = 595 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VSDITK+ KGWILNNLNVS LDYYY F+A+L +LNF+FF V F Sbjct: 515 VSDITKRHGHKGWILNNLNVSHLDYYYAFFAILNVLNFVFFLVVAKF 561 >ref|XP_006489758.1| PREDICTED: peptide transporter PTR3-A-like [Citrus sinensis] Length = 600 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VSDITK+ KGWILNNLN+S LDYYY F+A+L +LNF+FF V F Sbjct: 512 VSDITKRHGHKGWILNNLNISHLDYYYAFFAILNVLNFVFFLVVAKF 558 >ref|XP_006472979.1| PREDICTED: peptide transporter PTR3-A-like [Citrus sinensis] Length = 645 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VSDITK+ KGWILNNLN S LDYYY F+A+L +LNF+FF V F Sbjct: 565 VSDITKRHGHKGWILNNLNASHLDYYYAFFAILNVLNFVFFLVVAKF 611 >ref|XP_007035207.1| Peptide transporter PTR3-A [Theobroma cacao] gi|508714236|gb|EOY06133.1| Peptide transporter PTR3-A [Theobroma cacao] Length = 512 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VSDITKK +GWILNNLN S LDYYY F+A+L LNFIFF V+ F Sbjct: 433 VSDITKKHGHQGWILNNLNKSHLDYYYAFFAILNFLNFIFFLVVIKF 479 >ref|XP_006433551.1| hypothetical protein CICLE_v10003924mg [Citrus clementina] gi|557535673|gb|ESR46791.1| hypothetical protein CICLE_v10003924mg [Citrus clementina] Length = 595 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VSDITK+ KGWILNNLNV LDYYY F+A+L +LNF+FF V F Sbjct: 515 VSDITKRHGHKGWILNNLNVCHLDYYYAFFAILNVLNFVFFLVVAKF 561 >ref|XP_006420305.1| hypothetical protein CICLE_v10004600mg [Citrus clementina] gi|557522178|gb|ESR33545.1| hypothetical protein CICLE_v10004600mg [Citrus clementina] Length = 592 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VS+ITK+ KGWILNNLNVS LDYYY F+A+L +LNF+FF V F Sbjct: 512 VSNITKRHGHKGWILNNLNVSHLDYYYAFFAILNVLNFVFFLVVAKF 558 >ref|XP_006420304.1| hypothetical protein CICLE_v10004600mg [Citrus clementina] gi|557522177|gb|ESR33544.1| hypothetical protein CICLE_v10004600mg [Citrus clementina] Length = 482 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VS+ITK+ KGWILNNLNVS LDYYY F+A+L +LNF+FF V F Sbjct: 402 VSNITKRHGHKGWILNNLNVSHLDYYYAFFAILNVLNFVFFLVVAKF 448 >ref|XP_006420303.1| hypothetical protein CICLE_v10004600mg [Citrus clementina] gi|557522176|gb|ESR33543.1| hypothetical protein CICLE_v10004600mg [Citrus clementina] Length = 549 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VS+ITK+ KGWILNNLNVS LDYYY F+A+L +LNF+FF V F Sbjct: 469 VSNITKRHGHKGWILNNLNVSHLDYYYAFFAILNVLNFVFFLVVAKF 515 >ref|XP_006489657.1| PREDICTED: peptide transporter PTR3-A-like [Citrus sinensis] Length = 595 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VSD TK+ KGWILNNLNVS LDYYY F+A+L +LNF+FF V F Sbjct: 515 VSDKTKRHGHKGWILNNLNVSHLDYYYAFFAILNVLNFVFFLVVAKF 561 >ref|XP_006420320.1| hypothetical protein CICLE_v10006425mg [Citrus clementina] gi|557522193|gb|ESR33560.1| hypothetical protein CICLE_v10006425mg [Citrus clementina] Length = 570 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VSD TK+ KGWILNNLNVS LDYYY F+A+L +LNF+FF + F Sbjct: 490 VSDKTKRHGRKGWILNNLNVSHLDYYYAFFAILNVLNFVFFLVMAKF 536 >ref|XP_002311689.2| proton-dependent oligopeptide transport family protein [Populus trichocarpa] gi|550333257|gb|EEE89056.2| proton-dependent oligopeptide transport family protein [Populus trichocarpa] Length = 590 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFF 59 VSDITKK +GWILNNLN S LDYYY F+A+L LNFIFF Sbjct: 511 VSDITKKHGHRGWILNNLNASHLDYYYAFFAILNFLNFIFF 551 >ref|XP_002314492.1| proton-dependent oligopeptide transport family protein [Populus trichocarpa] gi|222863532|gb|EEF00663.1| proton-dependent oligopeptide transport family protein [Populus trichocarpa] Length = 589 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/47 (65%), Positives = 35/47 (74%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VS ITKK +GWILNNLN S LDYYY F+A+L LNFIFF V+ F Sbjct: 511 VSHITKKHGHRGWILNNLNASHLDYYYAFFAILNFLNFIFFLGVIRF 557 >gb|AAL36413.1| putative peptide transporter protein [Arabidopsis thaliana] Length = 582 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VS+ITKK+ G+GWILNNLN S LDYYY F+AVL L+NFI F V+ F Sbjct: 515 VSEITKKR-GRGWILNNLNESRLDYYYLFFAVLNLVNFILFLVVVKF 560 >ref|NP_199417.1| peptide transporter 3 [Arabidopsis thaliana] gi|75171884|sp|Q9FNL7.1|PTR3_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.2; Short=AtNPF5.2; AltName: Full=Peptide transporter PTR3-A; Short=AtPTR3 gi|9757725|dbj|BAB08250.1| peptide transporter [Arabidopsis thaliana] gi|23297791|gb|AAN13027.1| peptide transporter [Arabidopsis thaliana] gi|332007949|gb|AED95332.1| peptide transporter 3 [Arabidopsis thaliana] Length = 582 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VS+ITKK+ G+GWILNNLN S LDYYY F+AVL L+NF+ F V+ F Sbjct: 515 VSEITKKR-GRGWILNNLNESRLDYYYLFFAVLNLVNFVLFLVVVKF 560 >ref|XP_002863431.1| hypothetical protein ARALYDRAFT_494374 [Arabidopsis lyrata subsp. lyrata] gi|297309266|gb|EFH39690.1| hypothetical protein ARALYDRAFT_494374 [Arabidopsis lyrata subsp. lyrata] Length = 582 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VS+ITKK+ G+GWILNNLN S LDYYY F+AVL L+NF+ F V+ F Sbjct: 515 VSEITKKR-GRGWILNNLNESRLDYYYLFFAVLNLVNFVLFLVVVKF 560 >ref|XP_007222061.1| hypothetical protein PRUPE_ppa003209mg [Prunus persica] gi|462418997|gb|EMJ23260.1| hypothetical protein PRUPE_ppa003209mg [Prunus persica] Length = 593 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFF 59 VS ITKK KGWILNNLN S LDYYY F+AVL LNFIFF Sbjct: 516 VSHITKKHGHKGWILNNLNASHLDYYYAFFAVLNALNFIFF 556 >ref|XP_004247558.1| PREDICTED: peptide transporter PTR3-A-like [Solanum lycopersicum] Length = 597 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTV 50 V+D+TKK KGWIL+NLNVS LDYYY FYAVL+ +N +FF V Sbjct: 522 VADVTKKNGHKGWILDNLNVSHLDYYYAFYAVLSFINLLFFIVV 565 >ref|XP_003556370.1| PREDICTED: peptide transporter PTR3-A-like [Glycine max] Length = 594 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 VS++TKK KGWILNNLN S LDYYY F+A+L LN IFF V F Sbjct: 517 VSNVTKKNGHKGWILNNLNESHLDYYYAFFAILNFLNLIFFAYVTRF 563 >ref|XP_003625335.1| Peptide transporter PTR3-A [Medicago truncatula] gi|355500350|gb|AES81553.1| Peptide transporter PTR3-A [Medicago truncatula] Length = 619 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -2 Query: 181 VSDITKKKSGKGWILNNLNVSLLDYYYWFYAVLTLLNFIFFPTVLSF 41 V++IT++ KGWILNNLN S LDYYY F A+L+LLNF+FF V F Sbjct: 522 VANITQRHGHKGWILNNLNTSRLDYYYVFLAILSLLNFLFFVVVAKF 568