BLASTX nr result
ID: Akebia23_contig00012186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00012186 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006473214.1| PREDICTED: embryogenesis-associated protein ... 80 4e-13 ref|XP_006473213.1| PREDICTED: embryogenesis-associated protein ... 80 4e-13 ref|XP_006473212.1| PREDICTED: embryogenesis-associated protein ... 80 4e-13 ref|XP_006654447.1| PREDICTED: embryogenesis-associated protein ... 79 5e-13 gb|EAY98161.1| hypothetical protein OsI_20077 [Oryza sativa Indi... 79 7e-13 ref|NP_001055633.1| Os05g0432600 [Oryza sativa Japonica Group] g... 79 7e-13 ref|XP_006434632.1| hypothetical protein CICLE_v10001139mg [Citr... 79 9e-13 ref|XP_002441157.1| hypothetical protein SORBIDRAFT_09g021390 [S... 79 9e-13 ref|XP_002526848.1| alpha/beta hydrolase domain containing prote... 79 9e-13 gb|EYU22861.1| hypothetical protein MIMGU_mgv1a003990mg [Mimulus... 77 3e-12 ref|XP_004961972.1| PREDICTED: embryogenesis-associated protein ... 77 3e-12 ref|XP_004961971.1| PREDICTED: embryogenesis-associated protein ... 77 3e-12 ref|XP_004961970.1| PREDICTED: embryogenesis-associated protein ... 77 3e-12 gb|EMT04871.1| Embryogenesis-associated protein EMB8 [Aegilops t... 77 3e-12 gb|EMS68737.1| Embryogenesis-associated protein EMB8 [Triticum u... 77 3e-12 dbj|BAK01955.1| predicted protein [Hordeum vulgare subsp. vulgare] 77 3e-12 gb|AFA36474.1| putative embryogenesis-associated protein, partia... 77 3e-12 ref|XP_003568383.1| PREDICTED: embryogenesis-associated protein ... 77 3e-12 ref|XP_003556207.1| PREDICTED: embryogenesis-associated protein ... 77 3e-12 ref|XP_003536378.1| PREDICTED: embryogenesis-associated protein ... 77 3e-12 >ref|XP_006473214.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X3 [Citrus sinensis] Length = 430 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED REV++YLH E PKAPLFA+GTSIGAN+LV Sbjct: 216 DCFYNAGWTEDAREVIEYLHHEYPKAPLFAIGTSIGANILV 256 >ref|XP_006473213.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X2 [Citrus sinensis] Length = 585 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED REV++YLH E PKAPLFA+GTSIGAN+LV Sbjct: 215 DCFYNAGWTEDAREVIEYLHHEYPKAPLFAIGTSIGANILV 255 >ref|XP_006473212.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X1 [Citrus sinensis] Length = 586 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED REV++YLH E PKAPLFA+GTSIGAN+LV Sbjct: 216 DCFYNAGWTEDAREVIEYLHHEYPKAPLFAIGTSIGANILV 256 >ref|XP_006654447.1| PREDICTED: embryogenesis-associated protein EMB8-like [Oryza brachyantha] Length = 407 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED RE+V+YLHQ+ P+APLFAVGTSIGANVLV Sbjct: 24 DCFYNAGWTEDFREIVNYLHQKYPQAPLFAVGTSIGANVLV 64 >gb|EAY98161.1| hypothetical protein OsI_20077 [Oryza sativa Indica Group] Length = 581 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED RE+V+YLHQ+ P+APLFAVGTSIGAN+LV Sbjct: 200 DCFYNAGWTEDFREIVNYLHQKYPQAPLFAVGTSIGANILV 240 >ref|NP_001055633.1| Os05g0432600 [Oryza sativa Japonica Group] gi|48843789|gb|AAT47048.1| putative embryogenesis-associated protein [Oryza sativa Japonica Group] gi|49328050|gb|AAT58751.1| putative embryogenesis-associated protein [Oryza sativa Japonica Group] gi|113579184|dbj|BAF17547.1| Os05g0432600 [Oryza sativa Japonica Group] gi|215717093|dbj|BAG95456.1| unnamed protein product [Oryza sativa Japonica Group] gi|222631693|gb|EEE63825.1| hypothetical protein OsJ_18649 [Oryza sativa Japonica Group] Length = 581 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED RE+V+YLHQ+ P+APLFAVGTSIGAN+LV Sbjct: 200 DCFYNAGWTEDFREIVNYLHQKYPQAPLFAVGTSIGANILV 240 >ref|XP_006434632.1| hypothetical protein CICLE_v10001139mg [Citrus clementina] gi|557536754|gb|ESR47872.1| hypothetical protein CICLE_v10001139mg [Citrus clementina] Length = 448 Score = 78.6 bits (192), Expect = 9e-13 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED REV+ YLH E PKAPLFA+GTSIGAN+LV Sbjct: 78 DCFYNAGWTEDAREVIGYLHHEYPKAPLFAIGTSIGANILV 118 >ref|XP_002441157.1| hypothetical protein SORBIDRAFT_09g021390 [Sorghum bicolor] gi|241946442|gb|EES19587.1| hypothetical protein SORBIDRAFT_09g021390 [Sorghum bicolor] Length = 596 Score = 78.6 bits (192), Expect = 9e-13 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED+REVV++LHQE PKAPLF VGTSIGAN++V Sbjct: 203 DCFYNAGWTEDMREVVNFLHQEYPKAPLFTVGTSIGANIVV 243 >ref|XP_002526848.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] gi|223533852|gb|EEF35583.1| alpha/beta hydrolase domain containing protein 1,3, putative [Ricinus communis] Length = 443 Score = 78.6 bits (192), Expect = 9e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED+R V++YLH E PKAPLFAVGTSIGAN+LV Sbjct: 97 DCFYNAGWTEDLRAVINYLHNEYPKAPLFAVGTSIGANILV 137 >gb|EYU22861.1| hypothetical protein MIMGU_mgv1a003990mg [Mimulus guttatus] Length = 551 Score = 77.0 bits (188), Expect = 3e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED+REV++YLHQE +APLF VGTSIGAN+LV Sbjct: 204 DCFYNAGWTEDVREVINYLHQEYSQAPLFVVGTSIGANILV 244 >ref|XP_004961972.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X3 [Setaria italica] Length = 588 Score = 77.0 bits (188), Expect = 3e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED+REVV+YLHQ+ P+APLF VGTSIGAN++V Sbjct: 197 DCFYNAGWTEDMREVVNYLHQKYPEAPLFTVGTSIGANIVV 237 >ref|XP_004961971.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X2 [Setaria italica] Length = 591 Score = 77.0 bits (188), Expect = 3e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED+REVV+YLHQ+ P+APLF VGTSIGAN++V Sbjct: 200 DCFYNAGWTEDMREVVNYLHQKYPEAPLFTVGTSIGANIVV 240 >ref|XP_004961970.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform X1 [Setaria italica] Length = 593 Score = 77.0 bits (188), Expect = 3e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED+REVV+YLHQ+ P+APLF VGTSIGAN++V Sbjct: 202 DCFYNAGWTEDMREVVNYLHQKYPEAPLFTVGTSIGANIVV 242 >gb|EMT04871.1| Embryogenesis-associated protein EMB8 [Aegilops tauschii] Length = 411 Score = 77.0 bits (188), Expect = 3e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYN GWTEDIREVV+YLHQ+ P+APLF VGTS+GAN+LV Sbjct: 24 DCFYNGGWTEDIREVVNYLHQKYPEAPLFTVGTSLGANILV 64 >gb|EMS68737.1| Embryogenesis-associated protein EMB8 [Triticum urartu] Length = 237 Score = 77.0 bits (188), Expect = 3e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYN GWTEDIREVV+YLHQ+ P+APLF VGTS+GAN+LV Sbjct: 123 DCFYNGGWTEDIREVVNYLHQKYPEAPLFTVGTSLGANILV 163 >dbj|BAK01955.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 594 Score = 77.0 bits (188), Expect = 3e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYN GWTEDIREVV+YLHQ+ P+APLF VGTS+GAN+LV Sbjct: 203 DCFYNGGWTEDIREVVNYLHQKYPQAPLFTVGTSLGANILV 243 >gb|AFA36474.1| putative embryogenesis-associated protein, partial [Lolium perenne] Length = 160 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYN GWTEDIREVV+YLHQ+ P+APLFAVG S+GAN+LV Sbjct: 84 DCFYNGGWTEDIREVVNYLHQKYPEAPLFAVGASLGANILV 124 >ref|XP_003568383.1| PREDICTED: embryogenesis-associated protein EMB8-like [Brachypodium distachyon] Length = 591 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTEDI EVV+Y+HQ+ P+APLF VGTSIGAN+LV Sbjct: 201 DCFYNAGWTEDIHEVVNYIHQKYPEAPLFTVGTSIGANILV 241 >ref|XP_003556207.1| PREDICTED: embryogenesis-associated protein EMB8-like [Glycine max] Length = 574 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED+R VV+YLH+E P+APLF VGTSIGAN+L+ Sbjct: 202 DCFYNAGWTEDVRTVVNYLHKENPRAPLFVVGTSIGANILI 242 >ref|XP_003536378.1| PREDICTED: embryogenesis-associated protein EMB8-like isoform 1 [Glycine max] Length = 578 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = +1 Query: 25 DCFYNAGWTEDIREVVDYLHQE*PKAPLFAVGTSIGANVLV 147 DCFYNAGWTED+R VV+YLH+E P+APLF VGTSIGAN+L+ Sbjct: 207 DCFYNAGWTEDVRTVVNYLHKENPRAPLFVVGTSIGANILI 247