BLASTX nr result
ID: Akebia23_contig00012135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00012135 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004507921.1| PREDICTED: transmembrane protein 230-like [C... 75 9e-12 ref|XP_003610004.1| hypothetical protein MTR_4g126790 [Medicago ... 75 9e-12 ref|XP_006366200.1| PREDICTED: transmembrane protein 230-like [S... 74 2e-11 ref|XP_004242695.1| PREDICTED: transmembrane protein 230-like is... 74 2e-11 ref|XP_004242694.1| PREDICTED: transmembrane protein 230-like is... 74 2e-11 ref|XP_002267083.1| PREDICTED: UPF0414 transmembrane protein C20... 74 2e-11 ref|XP_006845753.1| hypothetical protein AMTR_s00019p00248000 [A... 73 4e-11 ref|XP_007014453.1| Uncharacterized protein TCM_039526 [Theobrom... 73 4e-11 ref|XP_004488029.1| PREDICTED: transmembrane protein 230-like [C... 73 4e-11 ref|XP_007225964.1| hypothetical protein PRUPE_ppa013773mg [Prun... 73 4e-11 ref|NP_001237830.1| uncharacterized protein LOC100527046 [Glycin... 73 4e-11 ref|NP_001234961.1| uncharacterized protein LOC100500481 [Glycin... 73 5e-11 ref|XP_004965667.1| PREDICTED: transmembrane protein 230-like [S... 72 6e-11 ref|XP_002438789.1| hypothetical protein SORBIDRAFT_10g026270 [S... 72 6e-11 gb|ACJ85923.1| unknown [Medicago truncatula] gi|388505964|gb|AFK... 72 6e-11 gb|AFW87631.1| hypothetical protein ZEAMMB73_744901 [Zea mays] 72 8e-11 ref|XP_002530588.1| conserved hypothetical protein [Ricinus comm... 72 8e-11 gb|ABK25796.1| unknown [Picea sitchensis] 72 8e-11 gb|EYU37308.1| hypothetical protein MIMGU_mgv1a016886mg [Mimulus... 72 1e-10 ref|XP_004146339.1| PREDICTED: transmembrane protein 230-like [C... 72 1e-10 >ref|XP_004507921.1| PREDICTED: transmembrane protein 230-like [Cicer arietinum] Length = 102 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LGS+LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 67 AILGSILFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 102 >ref|XP_003610004.1| hypothetical protein MTR_4g126790 [Medicago truncatula] gi|355511059|gb|AES92201.1| hypothetical protein MTR_4g126790 [Medicago truncatula] gi|388503578|gb|AFK39855.1| unknown [Medicago truncatula] Length = 102 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LGS+LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 67 AILGSILFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 102 >ref|XP_006366200.1| PREDICTED: transmembrane protein 230-like [Solanum tuberosum] Length = 103 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG VLFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 68 AILGGVLFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 103 >ref|XP_004242695.1| PREDICTED: transmembrane protein 230-like isoform 2 [Solanum lycopersicum] Length = 103 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG VLFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 68 AILGGVLFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 103 >ref|XP_004242694.1| PREDICTED: transmembrane protein 230-like isoform 1 [Solanum lycopersicum] Length = 108 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG VLFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 73 AILGGVLFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 108 >ref|XP_002267083.1| PREDICTED: UPF0414 transmembrane protein C20orf30 homolog [Vitis vinifera] gi|147825386|emb|CAN75495.1| hypothetical protein VITISV_030526 [Vitis vinifera] gi|297735425|emb|CBI17865.3| unnamed protein product [Vitis vinifera] Length = 103 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG++LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 68 AILGAILFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 103 >ref|XP_006845753.1| hypothetical protein AMTR_s00019p00248000 [Amborella trichopoda] gi|548848325|gb|ERN07428.1| hypothetical protein AMTR_s00019p00248000 [Amborella trichopoda] Length = 102 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 235 LGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 LGS+LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 69 LGSLLFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 102 >ref|XP_007014453.1| Uncharacterized protein TCM_039526 [Theobroma cacao] gi|508784816|gb|EOY32072.1| Uncharacterized protein TCM_039526 [Theobroma cacao] Length = 104 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG +LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 69 AILGCILFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 104 >ref|XP_004488029.1| PREDICTED: transmembrane protein 230-like [Cicer arietinum] Length = 103 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG +LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 68 AILGMILFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 103 >ref|XP_007225964.1| hypothetical protein PRUPE_ppa013773mg [Prunus persica] gi|462422900|gb|EMJ27163.1| hypothetical protein PRUPE_ppa013773mg [Prunus persica] Length = 103 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG++LF+PGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 68 AILGAILFLPGFYYTRIAYYAYKGYKGFSFSNIPPV 103 >ref|NP_001237830.1| uncharacterized protein LOC100527046 [Glycine max] gi|255631438|gb|ACU16086.1| unknown [Glycine max] Length = 102 Score = 73.2 bits (178), Expect = 4e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG +LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 67 AVLGFILFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 102 >ref|NP_001234961.1| uncharacterized protein LOC100500481 [Glycine max] gi|255630425|gb|ACU15569.1| unknown [Glycine max] Length = 102 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG +LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 67 AILGFILFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 102 >ref|XP_004965667.1| PREDICTED: transmembrane protein 230-like [Setaria italica] Length = 103 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG V+FIPGFYYTRIAYYA+KGYKGFSFSNIPP+ Sbjct: 68 AVLGVVMFIPGFYYTRIAYYAYKGYKGFSFSNIPPI 103 >ref|XP_002438789.1| hypothetical protein SORBIDRAFT_10g026270 [Sorghum bicolor] gi|241917012|gb|EER90156.1| hypothetical protein SORBIDRAFT_10g026270 [Sorghum bicolor] Length = 103 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG V+FIPGFYYTRIAYYA+KGYKGFSFSNIPP+ Sbjct: 68 AVLGVVMFIPGFYYTRIAYYAYKGYKGFSFSNIPPI 103 >gb|ACJ85923.1| unknown [Medicago truncatula] gi|388505964|gb|AFK41048.1| unknown [Medicago truncatula] Length = 103 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG +LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 68 AILGMLLFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 103 >gb|AFW87631.1| hypothetical protein ZEAMMB73_744901 [Zea mays] Length = 103 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG V+FIPGFYYTRIAYYA+KGYKGF+FSNIPP+ Sbjct: 68 AVLGGVMFIPGFYYTRIAYYAYKGYKGFTFSNIPPI 103 >ref|XP_002530588.1| conserved hypothetical protein [Ricinus communis] gi|223529887|gb|EEF31818.1| conserved hypothetical protein [Ricinus communis] Length = 103 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG VLFIPGFYYTRIAYYA+KGYKGFSF+NIPPV Sbjct: 68 AILGVVLFIPGFYYTRIAYYAYKGYKGFSFANIPPV 103 >gb|ABK25796.1| unknown [Picea sitchensis] Length = 101 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG +LFIPGFYYTR+AYYA+KGYKGFSFSNIPPV Sbjct: 66 AILGGMLFIPGFYYTRLAYYAYKGYKGFSFSNIPPV 101 >gb|EYU37308.1| hypothetical protein MIMGU_mgv1a016886mg [Mimulus guttatus] Length = 103 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -3 Query: 241 AALGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 A LG +LF+PGFYYTRIAYYA+KGYKGFSF+NIPPV Sbjct: 68 AILGGILFLPGFYYTRIAYYAYKGYKGFSFANIPPV 103 >ref|XP_004146339.1| PREDICTED: transmembrane protein 230-like [Cucumis sativus] gi|449502986|ref|XP_004161798.1| PREDICTED: transmembrane protein 230-like [Cucumis sativus] Length = 103 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 235 LGSVLFIPGFYYTRIAYYAFKGYKGFSFSNIPPV 134 LG +LFIPGFYYTRIAYYA+KGYKGFSFSNIPPV Sbjct: 70 LGGLLFIPGFYYTRIAYYAYKGYKGFSFSNIPPV 103