BLASTX nr result
ID: Akebia23_contig00012115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00012115 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274528.1| PREDICTED: methionine aminopeptidase 1A [Vit... 111 1e-22 emb|CAN75821.1| hypothetical protein VITISV_005133 [Vitis vinifera] 111 1e-22 gb|ADE77791.1| unknown [Picea sitchensis] 109 3e-22 gb|EXB76238.1| Methionine aminopeptidase 1A [Morus notabilis] 109 4e-22 ref|XP_006347886.1| PREDICTED: methionine aminopeptidase 1A-like... 109 4e-22 ref|XP_007134836.1| hypothetical protein PHAVU_010G0804001g, par... 109 4e-22 ref|XP_004514335.1| PREDICTED: methionine aminopeptidase 1A-like... 105 6e-21 ref|XP_004229798.1| PREDICTED: methionine aminopeptidase 1A-like... 105 6e-21 ref|XP_002511681.1| methionine aminopeptidase, putative [Ricinus... 105 8e-21 gb|ABB91774.1| methionine aminopeptidase 1 [Ananas comosus] 105 8e-21 ref|XP_006573420.1| PREDICTED: methionine aminopeptidase 1A-like... 104 1e-20 ref|XP_004133928.1| PREDICTED: methionine aminopeptidase 1A-like... 104 1e-20 ref|XP_003517032.1| PREDICTED: methionine aminopeptidase 1A-like... 104 1e-20 ref|XP_006576425.1| PREDICTED: methionine aminopeptidase 1A-like... 104 1e-20 ref|XP_002320050.2| methionine aminopeptidase 1 family protein [... 104 1e-20 gb|EPS65207.1| methionine aminopeptidase, partial [Genlisea aurea] 104 1e-20 ref|XP_007218112.1| hypothetical protein PRUPE_ppa006771mg [Prun... 104 1e-20 ref|XP_003521931.1| PREDICTED: methionine aminopeptidase 1A-like... 104 1e-20 ref|XP_007134838.1| hypothetical protein PHAVU_010G080500g [Phas... 103 2e-20 ref|XP_004308462.1| PREDICTED: methionine aminopeptidase 1A-like... 103 2e-20 >ref|XP_002274528.1| PREDICTED: methionine aminopeptidase 1A [Vitis vinifera] gi|296089187|emb|CBI38890.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 111 bits (277), Expect = 1e-22 Identities = 50/65 (76%), Positives = 53/65 (81%) Frame = -1 Query: 195 TPDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAID 16 TP SAS N+GWLYCLKKGQ RT K+P FDWTG LRPYPISS R+VP HID PDWAID Sbjct: 65 TPAVQNSASPNEGWLYCLKKGQARTPKIPFFDWTGTLRPYPISSKRIVPDHIDLPDWAID 124 Query: 15 GIPKI 1 GIPKI Sbjct: 125 GIPKI 129 >emb|CAN75821.1| hypothetical protein VITISV_005133 [Vitis vinifera] Length = 723 Score = 111 bits (277), Expect = 1e-22 Identities = 50/65 (76%), Positives = 53/65 (81%) Frame = -1 Query: 195 TPDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAID 16 TP SAS N+GWLYCLKKGQ RT K+P FDWTG LRPYPISS R+VP HID PDWAID Sbjct: 67 TPAVQNSASPNEGWLYCLKKGQARTPKIPFFDWTGTLRPYPISSKRIVPDHIDLPDWAID 126 Query: 15 GIPKI 1 GIPKI Sbjct: 127 GIPKI 131 >gb|ADE77791.1| unknown [Picea sitchensis] Length = 400 Score = 109 bits (273), Expect = 3e-22 Identities = 47/65 (72%), Positives = 57/65 (87%) Frame = -1 Query: 195 TPDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAID 16 +P+E ISA+L++GWLYCLKKGQ+RTS+LP+FDW G LRPYPISS R+VP I KPDWA D Sbjct: 70 SPEEQISAALSRGWLYCLKKGQSRTSRLPYFDWLGPLRPYPISSKRLVPDSISKPDWASD 129 Query: 15 GIPKI 1 GIPK+ Sbjct: 130 GIPKV 134 >gb|EXB76238.1| Methionine aminopeptidase 1A [Morus notabilis] Length = 375 Score = 109 bits (272), Expect = 4e-22 Identities = 48/64 (75%), Positives = 52/64 (81%) Frame = -1 Query: 192 PDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDG 13 P E + N+GWLYCLKKGQ RTSKLP+FDWTG LRPYPIS R VP+HID PDWAIDG Sbjct: 71 PGEKKTDGANEGWLYCLKKGQARTSKLPYFDWTGPLRPYPISGKRAVPAHIDVPDWAIDG 130 Query: 12 IPKI 1 IPKI Sbjct: 131 IPKI 134 >ref|XP_006347886.1| PREDICTED: methionine aminopeptidase 1A-like [Solanum tuberosum] Length = 402 Score = 109 bits (272), Expect = 4e-22 Identities = 48/65 (73%), Positives = 53/65 (81%) Frame = -1 Query: 195 TPDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAID 16 TP E +AS + GWLYCL+KGQ RT K+PHFDWTG LRPYPIS RVVP+HID PDWA D Sbjct: 69 TPGEQNAASPSDGWLYCLRKGQARTPKIPHFDWTGTLRPYPISEKRVVPAHIDLPDWAND 128 Query: 15 GIPKI 1 GIPKI Sbjct: 129 GIPKI 133 >ref|XP_007134836.1| hypothetical protein PHAVU_010G0804001g, partial [Phaseolus vulgaris] gi|561007881|gb|ESW06830.1| hypothetical protein PHAVU_010G0804001g, partial [Phaseolus vulgaris] Length = 187 Score = 109 bits (272), Expect = 4e-22 Identities = 48/66 (72%), Positives = 55/66 (83%) Frame = -1 Query: 198 TTPDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAI 19 ++PD S S+++GWLYCLK GQ RT KLP+FDWTG+LRPYPISS RVVP IDKPDWA Sbjct: 63 SSPDTQNSGSVSEGWLYCLKSGQARTPKLPYFDWTGSLRPYPISSKRVVPDQIDKPDWAD 122 Query: 18 DGIPKI 1 DGIPKI Sbjct: 123 DGIPKI 128 >ref|XP_004514335.1| PREDICTED: methionine aminopeptidase 1A-like [Cicer arietinum] Length = 397 Score = 105 bits (262), Expect = 6e-21 Identities = 45/59 (76%), Positives = 51/59 (86%) Frame = -1 Query: 177 SASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDGIPKI 1 S SL +GWLYCLK+GQ+RT KLPHFDWTGALRPYPIS R+VP+HI PDWA DGIPK+ Sbjct: 70 SDSLGEGWLYCLKRGQSRTPKLPHFDWTGALRPYPISGKRIVPAHIVIPDWADDGIPKV 128 >ref|XP_004229798.1| PREDICTED: methionine aminopeptidase 1A-like [Solanum lycopersicum] Length = 402 Score = 105 bits (262), Expect = 6e-21 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -1 Query: 177 SASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDGIPKI 1 +AS + GWLYCL+KGQ RT K+PHFDWTG LRPYPIS RVVP+HID PDWA DGIPKI Sbjct: 75 AASPSDGWLYCLRKGQARTPKIPHFDWTGTLRPYPISEKRVVPAHIDLPDWANDGIPKI 133 >ref|XP_002511681.1| methionine aminopeptidase, putative [Ricinus communis] gi|223548861|gb|EEF50350.1| methionine aminopeptidase, putative [Ricinus communis] Length = 397 Score = 105 bits (261), Expect = 8e-21 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = -1 Query: 165 NQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDGIPKI 1 N+GW YCL++GQ RT KLP+FDWTG LRPYPIS RVVP+HIDKPDWA+DGIPKI Sbjct: 74 NEGWRYCLRRGQDRTPKLPYFDWTGTLRPYPISPYRVVPAHIDKPDWAVDGIPKI 128 >gb|ABB91774.1| methionine aminopeptidase 1 [Ananas comosus] Length = 395 Score = 105 bits (261), Expect = 8e-21 Identities = 45/69 (65%), Positives = 53/69 (76%) Frame = -1 Query: 207 KTGTTPDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPD 28 K T ++ S ++GW YCL+KGQ RTSKLP+FDWTG LRPYPIS MR VP I+KPD Sbjct: 57 KLATAASDVSSEQSDEGWQYCLRKGQMRTSKLPYFDWTGPLRPYPISKMREVPEGIEKPD 116 Query: 27 WAIDGIPKI 1 WA+DGIPKI Sbjct: 117 WAVDGIPKI 125 >ref|XP_006573420.1| PREDICTED: methionine aminopeptidase 1A-like isoform X2 [Glycine max] Length = 368 Score = 104 bits (260), Expect = 1e-20 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -1 Query: 177 SASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDGIPKI 1 S SL++GWLYCLK+GQ RT KLPHFDWTG L+PYPISS R+VP IDKPDWA DG PKI Sbjct: 41 SDSLDEGWLYCLKRGQARTPKLPHFDWTGPLQPYPISSKRIVPDQIDKPDWAGDGTPKI 99 >ref|XP_004133928.1| PREDICTED: methionine aminopeptidase 1A-like [Cucumis sativus] gi|449528877|ref|XP_004171428.1| PREDICTED: methionine aminopeptidase 1A-like [Cucumis sativus] Length = 402 Score = 104 bits (260), Expect = 1e-20 Identities = 45/55 (81%), Positives = 47/55 (85%) Frame = -1 Query: 165 NQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDGIPKI 1 N+GWLYCLKKGQ RT KLPHFDWTG LRPYPISS VP HID+PDWA DGIPKI Sbjct: 80 NEGWLYCLKKGQARTPKLPHFDWTGTLRPYPISSKCEVPPHIDRPDWADDGIPKI 134 >ref|XP_003517032.1| PREDICTED: methionine aminopeptidase 1A-like isoform X1 [Glycine max] Length = 397 Score = 104 bits (260), Expect = 1e-20 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -1 Query: 177 SASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDGIPKI 1 S SL++GWLYCLK+GQ RT KLPHFDWTG L+PYPISS R+VP IDKPDWA DG PKI Sbjct: 70 SDSLDEGWLYCLKRGQARTPKLPHFDWTGPLQPYPISSKRIVPDQIDKPDWAGDGTPKI 128 >ref|XP_006576425.1| PREDICTED: methionine aminopeptidase 1A-like isoform X2 [Glycine max] Length = 368 Score = 104 bits (259), Expect = 1e-20 Identities = 46/66 (69%), Positives = 51/66 (77%) Frame = -1 Query: 198 TTPDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAI 19 ++P S SL GWLYCLK+GQ RT KLPHFDWTG L+PYPISS R+VP IDKPDWA Sbjct: 34 SSPGTQNSDSLGDGWLYCLKRGQARTPKLPHFDWTGPLQPYPISSKRIVPDQIDKPDWAD 93 Query: 18 DGIPKI 1 DG PKI Sbjct: 94 DGTPKI 99 >ref|XP_002320050.2| methionine aminopeptidase 1 family protein [Populus trichocarpa] gi|550323634|gb|EEE98365.2| methionine aminopeptidase 1 family protein [Populus trichocarpa] Length = 397 Score = 104 bits (259), Expect = 1e-20 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -1 Query: 165 NQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDGIPKI 1 ++GWLYC+++GQ RT KLPHFDWTG LRPYPIS RVVP HID+PDWA+DGIPKI Sbjct: 73 SEGWLYCVRRGQGRTPKLPHFDWTGGLRPYPISPYRVVPPHIDRPDWAVDGIPKI 127 >gb|EPS65207.1| methionine aminopeptidase, partial [Genlisea aurea] Length = 400 Score = 104 bits (259), Expect = 1e-20 Identities = 45/64 (70%), Positives = 50/64 (78%) Frame = -1 Query: 192 PDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDG 13 P IS + GWLYCL++GQTRT K PHFDWTG LRPYPIS R VP+HID PDW+IDG Sbjct: 71 PGSQISGMPDDGWLYCLRRGQTRTPKQPHFDWTGPLRPYPISKRRFVPAHIDLPDWSIDG 130 Query: 12 IPKI 1 IPKI Sbjct: 131 IPKI 134 >ref|XP_007218112.1| hypothetical protein PRUPE_ppa006771mg [Prunus persica] gi|462414574|gb|EMJ19311.1| hypothetical protein PRUPE_ppa006771mg [Prunus persica] Length = 396 Score = 104 bits (259), Expect = 1e-20 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = -1 Query: 165 NQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDGIPKI 1 N+GWLYCLKKGQ RT KLP+FDWTG LRPYPISS R+VP+HID PDWA DG PK+ Sbjct: 73 NEGWLYCLKKGQARTPKLPYFDWTGTLRPYPISSKRMVPAHIDLPDWAADGTPKV 127 >ref|XP_003521931.1| PREDICTED: methionine aminopeptidase 1A-like isoform X1 [Glycine max] Length = 397 Score = 104 bits (259), Expect = 1e-20 Identities = 46/66 (69%), Positives = 51/66 (77%) Frame = -1 Query: 198 TTPDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAI 19 ++P S SL GWLYCLK+GQ RT KLPHFDWTG L+PYPISS R+VP IDKPDWA Sbjct: 63 SSPGTQNSDSLGDGWLYCLKRGQARTPKLPHFDWTGPLQPYPISSKRIVPDQIDKPDWAD 122 Query: 18 DGIPKI 1 DG PKI Sbjct: 123 DGTPKI 128 >ref|XP_007134838.1| hypothetical protein PHAVU_010G080500g [Phaseolus vulgaris] gi|561007883|gb|ESW06832.1| hypothetical protein PHAVU_010G080500g [Phaseolus vulgaris] Length = 397 Score = 103 bits (258), Expect = 2e-20 Identities = 46/66 (69%), Positives = 53/66 (80%) Frame = -1 Query: 198 TTPDEIISASLNQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAI 19 ++PD S SL +GWLYCLK+GQ+RT KLP+FDWTG+LRPYPIS R V IDKPDWA Sbjct: 63 SSPDTQNSGSLGEGWLYCLKRGQSRTPKLPYFDWTGSLRPYPISIKRFVSDQIDKPDWAD 122 Query: 18 DGIPKI 1 DGIPKI Sbjct: 123 DGIPKI 128 >ref|XP_004308462.1| PREDICTED: methionine aminopeptidase 1A-like [Fragaria vesca subsp. vesca] Length = 393 Score = 103 bits (258), Expect = 2e-20 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -1 Query: 165 NQGWLYCLKKGQTRTSKLPHFDWTGALRPYPISSMRVVPSHIDKPDWAIDGIPK 4 N+GWLYC+KKGQ+R+ KLP+F+WTG LRPYPISS RVVPSHID PDWA DGIPK Sbjct: 66 NEGWLYCMKKGQSRSPKLPYFEWTGTLRPYPISSKRVVPSHIDLPDWAADGIPK 119