BLASTX nr result
ID: Akebia23_contig00011610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00011610 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201191.1| hypothetical protein PRUPE_ppa002757mg [Prun... 61 2e-07 >ref|XP_007201191.1| hypothetical protein PRUPE_ppa002757mg [Prunus persica] gi|462396591|gb|EMJ02390.1| hypothetical protein PRUPE_ppa002757mg [Prunus persica] Length = 636 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Frame = +2 Query: 65 AGWDQSN--PSATPPQPSTGYNYYGEQGQTGSAQTNINYGYGQTP 193 AGWDQSN PS+ PPQ S+ YNYYG+Q GSA N +Y Y QTP Sbjct: 316 AGWDQSNQVPSSQPPQESSAYNYYGQQPPMGSAPPNPSYNYNQTP 360