BLASTX nr result
ID: Akebia23_contig00011462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00011462 (666 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005090428.1| orf1 gene product (mitochondrion) [Boea hygr... 57 1e-08 ref|XP_002535432.1| conserved hypothetical protein [Ricinus comm... 60 8e-07 >ref|YP_005090428.1| orf1 gene product (mitochondrion) [Boea hygrometrica] gi|340549501|gb|AEK53322.1| hypothetical protein (mitochondrion) [Boea hygrometrica] Length = 331 Score = 57.4 bits (137), Expect(2) = 1e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 614 IHSRKDYNTQKTPYLRSGMSDTSGERR 534 IHSRKDYNTQKTPYLRSGMSDTSG RR Sbjct: 305 IHSRKDYNTQKTPYLRSGMSDTSGARR 331 Score = 28.5 bits (62), Expect(2) = 1e-08 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -1 Query: 660 QKRGVAPLEPGKVTLN 613 +KR VAPLEPGKV +N Sbjct: 274 KKRRVAPLEPGKVIIN 289 >ref|XP_002535432.1| conserved hypothetical protein [Ricinus communis] gi|255597764|ref|XP_002536851.1| conserved hypothetical protein [Ricinus communis] gi|223518343|gb|EEF25532.1| conserved hypothetical protein [Ricinus communis] gi|223523131|gb|EEF26949.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/48 (64%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +2 Query: 506 RAPALLAFFTGARLMYHSSRS--*GKESSVCYNLYGNELRVTLPGSRG 643 ++ ALLAFFTGAR MYHSSRS GKESSVCYNLYG+E + + G Sbjct: 39 KSSALLAFFTGARRMYHSSRSPRSGKESSVCYNLYGDESHMLVENCSG 86