BLASTX nr result
ID: Akebia23_contig00010697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00010697 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC96494.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia ... 58 1e-06 >gb|EMC96494.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia compniacensis UAMH 10762] Length = 305 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/48 (56%), Positives = 30/48 (62%) Frame = -1 Query: 146 QTDFRPSHDTAYTGSTVGSPQQTGLVTDADPVHSTHAPHGSHGGYYTQ 3 Q D RPSH+T YTGSTV +P D H H PHG+HGGYYTQ Sbjct: 237 QHDTRPSHETGYTGSTVAAPGTASY--DKVDAHHGHQPHGTHGGYYTQ 282