BLASTX nr result
ID: Akebia23_contig00009623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00009623 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303842.1| hypothetical protein POPTR_0003s17950g [Popu... 110 2e-22 ref|XP_006356242.1| PREDICTED: probable CCR4-associated factor 1... 109 3e-22 ref|XP_007023408.1| Polynucleotidyl transferase, ribonuclease H-... 108 6e-22 ref|XP_007023405.1| Polynucleotidyl transferase, ribonuclease H-... 108 6e-22 ref|XP_007023403.1| Polynucleotidyl transferase, ribonuclease H-... 108 6e-22 ref|XP_006473977.1| PREDICTED: probable CCR4-associated factor 1... 108 1e-21 ref|XP_007135810.1| hypothetical protein PHAVU_010G160400g [Phas... 108 1e-21 ref|XP_006453661.1| hypothetical protein CICLE_v10009159mg [Citr... 108 1e-21 ref|XP_007202386.1| hypothetical protein PRUPE_ppa009376mg [Prun... 107 1e-21 ref|XP_007023407.1| CCR4-associated factor 1 [Theobroma cacao] g... 107 2e-21 ref|XP_004241682.1| PREDICTED: probable CCR4-associated factor 1... 107 2e-21 ref|XP_006356929.1| PREDICTED: probable CCR4-associated factor 1... 107 2e-21 gb|EXB50413.1| putative CCR4-associated factor 1-7-like protein ... 106 3e-21 ref|XP_004504674.1| PREDICTED: probable CCR4-associated factor 1... 106 4e-21 ref|XP_004507083.1| PREDICTED: probable CCR4-associated factor 1... 105 5e-21 ref|XP_002272165.1| PREDICTED: probable CCR4-associated factor 1... 105 9e-21 emb|CAN81811.1| hypothetical protein VITISV_020892 [Vitis vinifera] 105 9e-21 ref|XP_004250763.1| PREDICTED: probable CCR4-associated factor 1... 104 1e-20 ref|XP_003530297.1| PREDICTED: probable CCR4-associated factor 1... 104 1e-20 gb|ACU24625.1| unknown [Glycine max] 104 1e-20 >ref|XP_002303842.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa] gi|566163266|ref|XP_006385927.1| CCR4-NOT transcription complex family protein [Populus trichocarpa] gi|222841274|gb|EEE78821.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa] gi|550343417|gb|ERP63724.1| CCR4-NOT transcription complex family protein [Populus trichocarpa] Length = 274 Score = 110 bits (276), Expect = 2e-22 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPK DSIHIREVWNDNLEEEFALIR+IVDD+PYIAMDTEFPGIVLRPVGNFK Sbjct: 1 MSLLPKGDSIHIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFK 55 >ref|XP_006356242.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum tuberosum] Length = 273 Score = 109 bits (273), Expect = 3e-22 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPKSDSIHIREVWNDNLEEEF LIR+IVDDYP+IAMDTEFPG+VLRPVGNFK Sbjct: 1 MSLLPKSDSIHIREVWNDNLEEEFDLIREIVDDYPFIAMDTEFPGVVLRPVGNFK 55 >ref|XP_007023408.1| Polynucleotidyl transferase, ribonuclease H-like superfamily protein isoform 1 [Theobroma cacao] gi|590616096|ref|XP_007023409.1| Polynucleotidyl transferase, ribonuclease H-like superfamily protein isoform 1 [Theobroma cacao] gi|508778774|gb|EOY26030.1| Polynucleotidyl transferase, ribonuclease H-like superfamily protein isoform 1 [Theobroma cacao] gi|508778775|gb|EOY26031.1| Polynucleotidyl transferase, ribonuclease H-like superfamily protein isoform 1 [Theobroma cacao] Length = 274 Score = 108 bits (271), Expect = 6e-22 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPKSDSI IREVWNDNLEEEFALIR+IVDDYP++AMDTEFPGIVLRPVGNFK Sbjct: 1 MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPFVAMDTEFPGIVLRPVGNFK 55 >ref|XP_007023405.1| Polynucleotidyl transferase, ribonuclease H-like superfamily protein isoform 3, partial [Theobroma cacao] gi|508778771|gb|EOY26027.1| Polynucleotidyl transferase, ribonuclease H-like superfamily protein isoform 3, partial [Theobroma cacao] Length = 194 Score = 108 bits (271), Expect = 6e-22 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPKSDSI IREVWNDNLEEEFALIR+IVDDYPY+AMDTEFPG+VLRP+GNFK Sbjct: 1 MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFK 55 >ref|XP_007023403.1| Polynucleotidyl transferase, ribonuclease H-like superfamily protein isoform 1 [Theobroma cacao] gi|508778769|gb|EOY26025.1| Polynucleotidyl transferase, ribonuclease H-like superfamily protein isoform 1 [Theobroma cacao] Length = 274 Score = 108 bits (271), Expect = 6e-22 Identities = 49/55 (89%), Positives = 54/55 (98%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPKSDSI IREVWNDNLEEEFALIR+IVDDYPY+AMDTEFPG+VLRP+GNFK Sbjct: 1 MSLLPKSDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFK 55 >ref|XP_006473977.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus sinensis] Length = 274 Score = 108 bits (269), Expect = 1e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MSILPKS+SIHIREVWNDNLE EF+LIRDIVDDYPYIAMDTEFPGIVLR +GNFK Sbjct: 1 MSILPKSESIHIREVWNDNLEHEFSLIRDIVDDYPYIAMDTEFPGIVLRSIGNFK 55 >ref|XP_007135810.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris] gi|561008855|gb|ESW07804.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris] Length = 283 Score = 108 bits (269), Expect = 1e-21 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 160 ILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 ILPKSDSI IREVWNDNLEEEFALIR+IVDDYPYIAMDTEFPGIVLRPVGNFK Sbjct: 4 ILPKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFK 56 >ref|XP_006453661.1| hypothetical protein CICLE_v10009159mg [Citrus clementina] gi|557556887|gb|ESR66901.1| hypothetical protein CICLE_v10009159mg [Citrus clementina] Length = 274 Score = 108 bits (269), Expect = 1e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MSILPKS+SIHIREVWNDNLE EF+LIRDIVDDYPYIAMDTEFPGIVLR +GNFK Sbjct: 1 MSILPKSESIHIREVWNDNLEHEFSLIRDIVDDYPYIAMDTEFPGIVLRSIGNFK 55 >ref|XP_007202386.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica] gi|462397917|gb|EMJ03585.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica] Length = 295 Score = 107 bits (268), Expect = 1e-21 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 6/70 (8%) Frame = -1 Query: 193 GIVVCFGC------KMSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPG 32 G+V+C KMS+L KSDSIHIREVWNDNLE+EF LIR IVDDYPYIAMDTEFPG Sbjct: 7 GLVICINLCCSCENKMSLLTKSDSIHIREVWNDNLEKEFELIRKIVDDYPYIAMDTEFPG 66 Query: 31 IVLRPVGNFK 2 IVLRP+G FK Sbjct: 67 IVLRPIGTFK 76 >ref|XP_007023407.1| CCR4-associated factor 1 [Theobroma cacao] gi|508778773|gb|EOY26029.1| CCR4-associated factor 1 [Theobroma cacao] Length = 356 Score = 107 bits (267), Expect = 2e-21 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPK DSI IREVWNDNLEEEFALIR+IVDDYPY+AMDTEFPG+VLRP+GNFK Sbjct: 1 MSLLPKGDSIQIREVWNDNLEEEFALIREIVDDYPYVAMDTEFPGVVLRPLGNFK 55 >ref|XP_004241682.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum lycopersicum] Length = 274 Score = 107 bits (267), Expect = 2e-21 Identities = 48/55 (87%), Positives = 54/55 (98%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPKSDSIHIREVW+DNLEEEF LIR++VDDYP+IAMDTEFPG+VLRPVGNFK Sbjct: 1 MSLLPKSDSIHIREVWSDNLEEEFDLIREVVDDYPFIAMDTEFPGVVLRPVGNFK 55 >ref|XP_006356929.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum tuberosum] Length = 274 Score = 107 bits (266), Expect = 2e-21 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPK+DSI IREVW+DNLEEEFALIR IVDDYPYIAMDTEFPG+VLRPVGNFK Sbjct: 1 MSVLPKTDSIQIREVWSDNLEEEFALIRQIVDDYPYIAMDTEFPGVVLRPVGNFK 55 >gb|EXB50413.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis] Length = 277 Score = 106 bits (265), Expect = 3e-21 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 M LPK+DSIHIREVWNDNL+EEFALIRDIVD YPY+AMDTEFPGIVLRPVGNFK Sbjct: 1 MPELPKTDSIHIREVWNDNLDEEFALIRDIVDQYPYVAMDTEFPGIVLRPVGNFK 55 >ref|XP_004504674.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer arietinum] Length = 282 Score = 106 bits (264), Expect = 4e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 160 ILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 ILPKSDSI IREVW+DNLEEEFALIR+IVDDYPYIAMDTEFPGIVLRPVGNFK Sbjct: 10 ILPKSDSIQIREVWSDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFK 62 >ref|XP_004507083.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer arietinum] Length = 277 Score = 105 bits (263), Expect = 5e-21 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = -1 Query: 160 ILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 ILPKSD I IREVWNDNLEEEFALIR+IVDDYPYIAMDTEFPGIVLRPVGNFK Sbjct: 4 ILPKSDLIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFK 56 >ref|XP_002272165.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 1 [Vitis vinifera] Length = 274 Score = 105 bits (261), Expect = 9e-21 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPKSDSI IREVWNDNLEEEFALIR IVD++P+IAMDTEFPGIVLRPVGNFK Sbjct: 1 MSLLPKSDSIQIREVWNDNLEEEFALIRGIVDEFPFIAMDTEFPGIVLRPVGNFK 55 >emb|CAN81811.1| hypothetical protein VITISV_020892 [Vitis vinifera] Length = 179 Score = 105 bits (261), Expect = 9e-21 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -1 Query: 166 MSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 MS+LPKSDSI IREVWNDNLEEEFALIR IVD++P+IAMDTEFPGIVLRPVGNFK Sbjct: 1 MSLLPKSDSIQIREVWNDNLEEEFALIRGIVDEFPFIAMDTEFPGIVLRPVGNFK 55 >ref|XP_004250763.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 1 [Solanum lycopersicum] Length = 314 Score = 104 bits (260), Expect = 1e-20 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 169 KMSILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 +MS+LPK DSI IREVW+DNLE+EFALIR IVDDYPYIAMDTEFPG+VLRPVGNFK Sbjct: 40 RMSVLPKIDSIKIREVWSDNLEKEFALIRQIVDDYPYIAMDTEFPGVVLRPVGNFK 95 >ref|XP_003530297.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 1 [Glycine max] gi|356523340|ref|XP_003530298.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 2 [Glycine max] Length = 277 Score = 104 bits (260), Expect = 1e-20 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 160 ILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 +L KSDSI IREVWNDNLEEEFALIR+IVDDYPYIAMDTEFPGIVLRPVGNFK Sbjct: 4 VLAKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFK 56 >gb|ACU24625.1| unknown [Glycine max] Length = 277 Score = 104 bits (260), Expect = 1e-20 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = -1 Query: 160 ILPKSDSIHIREVWNDNLEEEFALIRDIVDDYPYIAMDTEFPGIVLRPVGNFK 2 +L KSDSI IREVWNDNLEEEFALIR+IVDDYPYIAMDTEFPGIVLRPVGNFK Sbjct: 4 VLAKSDSIQIREVWNDNLEEEFALIREIVDDYPYIAMDTEFPGIVLRPVGNFK 56