BLASTX nr result
ID: Akebia23_contig00008946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00008946 (1026 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD30865.1| putative RF3 protein [Ximenia americana] 62 5e-07 ref|YP_001294271.1| photosystem I assembly protein ycf3 [Illiciu... 60 2e-06 gb|AAX45879.1| hypothetical chloroplast RF3 [Zygnema circumcarin... 59 4e-06 ref|YP_007353767.1| photosystem I assembly protein Ycf3 (chlorop... 59 4e-06 ref|YP_005089335.1| ycf3 gene product (chloroplast) [Silene vulg... 59 4e-06 ref|YP_001837361.1| photosystem I assembly protein Ycf3 [Guizoti... 59 4e-06 sp|A6MMK8.1|YCF3_DIOEL RecName: Full=Photosystem I assembly prot... 59 4e-06 ref|YP_001294185.1| photosystem I assembly protein ycf3 [Buxus m... 59 4e-06 ref|YP_588118.1| photosystem I assembly protein Ycf3 (chloroplas... 59 4e-06 ref|YP_007475705.1| hypothetical chloroplast RF34 [Zingiber spec... 58 6e-06 ref|YP_538936.1| photosystem I assembly protein Ycf3 [Gossypium ... 58 6e-06 ref|YP_006503444.1| photosystem I assembly protein Ycf3 (chlorop... 58 6e-06 ref|YP_006503693.1| Ycf3 (chloroplast) [Erycina pusilla] gi|3394... 58 6e-06 ref|YP_008854595.1| hypothetical chloroplast RF34 [Curcuma rosco... 58 6e-06 gb|AEZ48786.1| photosystem I assembly protein Ycf3, partial [Pot... 58 6e-06 ref|YP_003934292.1| hypothetical chloroplast RF34 [Monsonia spec... 58 6e-06 ref|YP_784474.1| photosystem I assembly protein ycf3 [Piper ceno... 58 6e-06 ref|YP_008081366.1| photosystem I assembly protein Ycf3 (chlorop... 58 7e-06 gb|AAZ03961.1| Ycf3 [Acorus americanus] 58 7e-06 ref|YP_053156.1| photosystem I assembly protein Ycf3 [Nymphaea a... 58 7e-06 >gb|ADD30865.1| putative RF3 protein [Ximenia americana] Length = 168 Score = 61.6 bits (148), Expect = 5e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 M R ++NENFIDK S++ANIL R+IPTTSREKEAFTYY Sbjct: 1 MPRSRVNENFIDKTFSIVANILLRIIPTTSREKEAFTYY 39 >ref|YP_001294271.1| photosystem I assembly protein ycf3 [Illicium oligandrum] gi|172048704|sp|A6MMU5.1|YCF3_ILLOL RecName: Full=Photosystem I assembly protein Ycf3 gi|147917396|gb|ABQ52520.1| photosystem I assembly protein ycf3 [Illicium oligandrum] Length = 168 Score = 59.7 bits (143), Expect = 2e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 MSR +IN NFIDK +S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MSRSRINGNFIDKTSSIVANILLRIIPTTSGEKEAFTYY 39 >gb|AAX45879.1| hypothetical chloroplast RF3 [Zygnema circumcarinatum] Length = 186 Score = 58.5 bits (140), Expect = 4e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 571 LLTMSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 L TM R Q N+NFIDK +++A+IL R+IPTT REKEAFTYY Sbjct: 17 LFTMPRSQRNDNFIDKTFTIVADILLRVIPTTQREKEAFTYY 58 >ref|YP_007353767.1| photosystem I assembly protein Ycf3 (chloroplast) [Chrysanthemum x morifolium] gi|372863446|gb|AEX99515.1| photosystem I assembly protein Ycf3 (chloroplast) [Chrysanthemum indicum] gi|375298836|gb|AFA45275.1| photosystem I assembly protein Ycf3 (chloroplast) [Chrysanthemum x morifolium] Length = 167 Score = 58.5 bits (140), Expect = 4e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 MSR +IN NFIDK S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MSRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY 39 >ref|YP_005089335.1| ycf3 gene product (chloroplast) [Silene vulgaris] gi|374249789|ref|YP_005089418.1| ycf3 gene product (chloroplast) [Silene noctiflora] gi|374249878|ref|YP_005089506.1| ycf3 gene product (chloroplast) [Silene conica] gi|374249951|ref|YP_005089578.1| ycf3 gene product (chloroplast) [Silene latifolia] gi|575925640|ref|YP_009000025.1| hypothetical chloroplast RF34 (chloroplast) [Silene conoidea] gi|329755449|gb|AEC04013.1| hypothetical chloroplast RF34 (chloroplast) [Silene conica] gi|329755522|gb|AEC04085.1| hypothetical chloroplast RF34 (chloroplast) [Silene latifolia] gi|329755606|gb|AEC04168.1| hypothetical chloroplast RF34 (chloroplast) [Silene noctiflora] gi|329755687|gb|AEC04248.1| hypothetical chloroplast RF34 (chloroplast) [Silene vulgaris] gi|555944112|gb|AGZ18015.1| hypothetical chloroplast RF34 (chloroplast) [Silene conoidea] Length = 168 Score = 58.5 bits (140), Expect = 4e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 MSR +IN NFIDK S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MSRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY 39 >ref|YP_001837361.1| photosystem I assembly protein Ycf3 [Guizotia abyssinica] gi|179366257|gb|ACB86528.1| hypothetical chloroplast RF34 [Guizotia abyssinica] Length = 168 Score = 58.5 bits (140), Expect = 4e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 MSR +IN NFIDK S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MSRERINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY 39 >sp|A6MMK8.1|YCF3_DIOEL RecName: Full=Photosystem I assembly protein Ycf3 gi|148668047|gb|ABR01431.1| photosystem I assembly protein ycf3 [Dioscorea elephantipes] Length = 172 Score = 58.5 bits (140), Expect = 4e-06 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY*NCAI 711 M R QIN NFIDK +S++ANIL R+IPTTS EK+AFTYY + AI Sbjct: 1 MPRSQINGNFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGAI 44 >ref|YP_001294185.1| photosystem I assembly protein ycf3 [Buxus microphylla] gi|172048677|sp|A6MM37.1|YCF3_BUXMI RecName: Full=Photosystem I assembly protein Ycf3 gi|146762286|gb|ABQ45250.1| photosystem I assembly protein ycf3 [Buxus microphylla] Length = 168 Score = 58.5 bits (140), Expect = 4e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 MSR +IN NFIDK S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MSRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY 39 >ref|YP_588118.1| photosystem I assembly protein Ycf3 (chloroplast) [Helianthus annuus] gi|334701803|ref|YP_004564373.1| hypothetical chloroplast RF34 (chloroplast) [Ageratina adenophora] gi|334702325|ref|YP_004465188.1| hypothetical chloroplast RF34 [Jacobaea vulgaris] gi|452849052|ref|YP_007474730.1| photosystem I assembly protein Ycf3 (chloroplast) [Chrysanthemum indicum] gi|470227709|ref|YP_007624796.1| photosystem I assembly protein Ycf3 (chloroplast) [Artemisia frigida] gi|568245208|ref|YP_008964358.1| hypothetical chloroplast RF34 [Helianthus divaricatus] gi|568245294|ref|YP_008964443.1| hypothetical chloroplast RF34 [Helianthus decapetalus] gi|568245380|ref|YP_008964698.1| hypothetical chloroplast RF34 [Helianthus strumosus] gi|568245466|ref|YP_008964783.1| hypothetical chloroplast RF34 [Helianthus maximiliani] gi|568247158|ref|YP_008964188.1| hypothetical chloroplast RF34 [Helianthus giganteus] gi|568247244|ref|YP_008964273.1| hypothetical chloroplast RF34 [Helianthus grosseserratus] gi|568247330|ref|YP_008964528.1| hypothetical chloroplast RF34 [Helianthus hirsutus] gi|568247416|ref|YP_008964613.1| hypothetical chloroplast RF34 [Helianthus tuberosus] gi|598324126|ref|YP_009020744.1| hypothetical chloroplast RF34 (chloroplast) [Praxelis clematidea] gi|122225259|sp|Q1KXV8.1|YCF3_HELAN RecName: Full=Photosystem I assembly protein Ycf3 gi|88656896|gb|ABD47147.1| photosystem I assembly protein ycf3 (chloroplast) [Helianthus annuus] gi|308156083|gb|ADO15411.1| hypothetical chloroplast RF34 [Jacobaea vulgaris] gi|334089674|gb|AEG64557.1| hypothetical chloroplast RF34 (chloroplast) [Ageratina adenophora] gi|372863207|gb|AEX99279.1| photosystem I assembly protein Ycf3 (chloroplast) [Chrysanthemum indicum] gi|401712197|gb|AFP98822.1| photosystem I assembly protein Ycf3 (chloroplast) [Artemisia frigida] gi|559768016|gb|AHB14458.1| hypothetical chloroplast RF34 [Helianthus giganteus] gi|559768102|gb|AHB14543.1| hypothetical chloroplast RF34 [Helianthus giganteus] gi|559768188|gb|AHB14628.1| hypothetical chloroplast RF34 [Helianthus giganteus] gi|559768274|gb|AHB14713.1| hypothetical chloroplast RF34 [Helianthus giganteus] gi|559768360|gb|AHB14798.1| hypothetical chloroplast RF34 [Helianthus grosseserratus] gi|559768446|gb|AHB14883.1| hypothetical chloroplast RF34 [Helianthus grosseserratus] gi|559768532|gb|AHB14968.1| hypothetical chloroplast RF34 [Helianthus divaricatus] gi|559768618|gb|AHB15053.1| hypothetical chloroplast RF34 [Helianthus divaricatus] gi|559768704|gb|AHB15138.1| hypothetical chloroplast RF34 [Helianthus divaricatus] gi|559768790|gb|AHB15223.1| hypothetical chloroplast RF34 [Helianthus divaricatus] gi|559768876|gb|AHB15308.1| hypothetical chloroplast RF34 [Helianthus decapetalus] gi|559768962|gb|AHB15393.1| hypothetical chloroplast RF34 [Helianthus decapetalus] gi|559769048|gb|AHB15478.1| hypothetical chloroplast RF34 [Helianthus decapetalus] gi|559769134|gb|AHB15563.1| hypothetical chloroplast RF34 [Helianthus hirsutus] gi|559769220|gb|AHB15648.1| hypothetical chloroplast RF34 [Helianthus hirsutus] gi|559769306|gb|AHB15733.1| hypothetical chloroplast RF34 [Helianthus tuberosus] gi|559769392|gb|AHB15818.1| hypothetical chloroplast RF34 [Helianthus tuberosus] gi|559769478|gb|AHB15903.1| hypothetical chloroplast RF34 [Helianthus tuberosus] gi|559769564|gb|AHB15988.1| hypothetical chloroplast RF34 [Helianthus divaricatus] gi|559769650|gb|AHB16073.1| hypothetical chloroplast RF34 [Helianthus giganteus] gi|559769736|gb|AHB16158.1| hypothetical chloroplast RF34 [Helianthus giganteus] gi|559769822|gb|AHB16243.1| hypothetical chloroplast RF34 [Helianthus grosseserratus] gi|559769908|gb|AHB16328.1| hypothetical chloroplast RF34 [Helianthus grosseserratus] gi|559769994|gb|AHB16413.1| hypothetical chloroplast RF34 [Helianthus grosseserratus] gi|559770080|gb|AHB16498.1| hypothetical chloroplast RF34 [Helianthus grosseserratus] gi|559770166|gb|AHB16583.1| hypothetical chloroplast RF34 [Helianthus decapetalus] gi|559770252|gb|AHB16668.1| hypothetical chloroplast RF34 [Helianthus decapetalus] gi|559770338|gb|AHB16753.1| hypothetical chloroplast RF34 [Helianthus decapetalus] gi|559770424|gb|AHB16838.1| hypothetical chloroplast RF34 [Helianthus hirsutus] gi|559770510|gb|AHB16923.1| hypothetical chloroplast RF34 [Helianthus hirsutus] gi|559770596|gb|AHB17008.1| hypothetical chloroplast RF34 [Helianthus strumosus] gi|559770682|gb|AHB17093.1| hypothetical chloroplast RF34 [Helianthus tuberosus] gi|559770768|gb|AHB17178.1| hypothetical chloroplast RF34 [Helianthus tuberosus] gi|559770854|gb|AHB17263.1| hypothetical chloroplast RF34 [Helianthus tuberosus] gi|559770940|gb|AHB17348.1| hypothetical chloroplast RF34 [Helianthus maximiliani] gi|559771026|gb|AHB17433.1| hypothetical chloroplast RF34 [Helianthus maximiliani] gi|559771112|gb|AHB17518.1| hypothetical chloroplast RF34 [Helianthus maximiliani] gi|559771198|gb|AHB17603.1| hypothetical chloroplast RF34 [Helianthus maximiliani] gi|594543323|gb|AHM02404.1| hypothetical chloroplast RF34 (chloroplast) [Praxelis clematidea] Length = 168 Score = 58.5 bits (140), Expect = 4e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 MSR +IN NFIDK S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MSRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY 39 >ref|YP_007475705.1| hypothetical chloroplast RF34 [Zingiber spectabile] gi|449326185|gb|AGE92770.1| hypothetical chloroplast RF34 [Zingiber spectabile] Length = 169 Score = 58.2 bits (139), Expect = 6e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 M R QIN NFIDK +S++ANIL R+IPTTS EK+AFTYY Sbjct: 1 MPRSQINANFIDKTSSIVANILLRIIPTTSGEKKAFTYY 39 >ref|YP_538936.1| photosystem I assembly protein Ycf3 [Gossypium hirsutum] gi|119368500|ref|YP_913188.1| PSI accumulation protein [Gossypium barbadense] gi|325210931|ref|YP_004286005.1| hypothetical chloroplast RF34 [Gossypium thurberi] gi|372290933|ref|YP_005087694.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium raimondii] gi|372291032|ref|YP_005087790.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium darwinii] gi|372291386|ref|YP_005088281.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium tomentosum] gi|372291484|ref|YP_005088377.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291774|ref|YP_005088917.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium mustelinum] gi|372291858|ref|YP_005089000.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium arboreum] gi|386800838|ref|YP_006303492.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium gossypioides] gi|394830627|ref|YP_006503278.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium incanum] gi|394830714|ref|YP_006503361.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium somalense] gi|394830889|ref|YP_006503527.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium areysianum] gi|394830976|ref|YP_006503610.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium robinsonii] gi|570758969|ref|YP_008992551.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium bickii] gi|570759057|ref|YP_008992896.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium sturtianum] gi|570759577|ref|YP_008992638.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium herbaceum] gi|570759663|ref|YP_008992724.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium longicalyx] gi|570879914|ref|YP_008992810.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium stocksii] gi|122226162|sp|Q2L906.1|YCF3_GOSHI RecName: Full=Photosystem I assembly protein Ycf3 gi|125991253|sp|A0ZZ36.1|YCF3_GOSBA RecName: Full=Photosystem I assembly protein Ycf3 gi|85687417|gb|ABC73629.1| photosystem I assembly protein ycf3 [Gossypium hirsutum] gi|119224862|dbj|BAF41248.1| PSI accumulation protein [Gossypium barbadense] gi|290775793|gb|ADD62289.1| hypothetical chloroplast RF34 [Gossypium thurberi] gi|318084317|gb|ADV38793.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium arboreum] gi|318084400|gb|ADV38875.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium darwinii] gi|318084485|gb|ADV38959.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084569|gb|ADV39042.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium mustelinum] gi|318084651|gb|ADV39123.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium raimondii] gi|318084737|gb|ADV39208.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium tomentosum] gi|326457128|gb|ADZ74391.1| hypothetical chloroplast RF34 [Gossypium bickii] gi|326457216|gb|ADZ74478.1| hypothetical chloroplast RF34 [Gossypium herbaceum] gi|326457302|gb|ADZ74563.1| hypothetical chloroplast RF34 [Gossypium longicalyx] gi|326457389|gb|ADZ74649.1| hypothetical chloroplast RF34 [Gossypium stocksii] gi|326457477|gb|ADZ74736.1| hypothetical chloroplast RF34 [Gossypium sturtianum] gi|329317072|gb|AEB90431.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium gossypioides] gi|329317156|gb|AEB90514.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium hirsutum] gi|329317240|gb|AEB90597.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium hirsutum] gi|329317324|gb|AEB90680.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|329317408|gb|AEB90763.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|329317492|gb|AEB90846.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium barbadense] gi|335354332|gb|AEH42952.1| photosystem I assembly protein Ycf3 [Gossypium incanum] gi|335354416|gb|AEH43035.1| photosystem I assembly protein Ycf3 [Gossypium somalense] gi|335354584|gb|AEH43201.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium areysianum] gi|335354668|gb|AEH43284.1| photosystem I assembly protein Ycf3 [Gossypium robinsonii] Length = 168 Score = 58.2 bits (139), Expect = 6e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 M R QIN NFIDK S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY 39 >ref|YP_006503444.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium capitis-viridis] gi|570758881|ref|YP_008992465.1| hypothetical chloroplast RF34 (chloroplast) [Gossypium anomalum] gi|326457040|gb|ADZ74304.1| hypothetical chloroplast RF34 [Gossypium anomalum] gi|335354500|gb|AEH43118.1| photosystem I assembly protein Ycf3 (chloroplast) [Gossypium capitis-viridis] Length = 168 Score = 58.2 bits (139), Expect = 6e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 M R QIN NFIDK S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY 39 >ref|YP_006503693.1| Ycf3 (chloroplast) [Erycina pusilla] gi|339431305|gb|AEJ72499.1| Ycf3 (chloroplast) [Erycina pusilla] Length = 168 Score = 58.2 bits (139), Expect = 6e-06 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 MSR +IN NFIDK +S++ANIL R+IPTTS EK+AFTYY Sbjct: 1 MSRSRINGNFIDKTSSIVANILLRIIPTTSGEKKAFTYY 39 >ref|YP_008854595.1| hypothetical chloroplast RF34 [Curcuma roscoeana] gi|374411597|gb|AEZ48789.1| photosystem I assembly protein Ycf3, partial [Renealmia alpinia] gi|449326793|gb|AGE93371.1| hypothetical chloroplast RF34 [Alpinia zerumbet] gi|557637502|gb|AHA13097.1| hypothetical chloroplast RF34 [Curcuma roscoeana] Length = 168 Score = 58.2 bits (139), Expect = 6e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 M R QIN NFIDK +S++ANIL R+IPTTS EK+AFTYY Sbjct: 1 MPRSQINANFIDKTSSIVANILLRIIPTTSGEKKAFTYY 39 >gb|AEZ48786.1| photosystem I assembly protein Ycf3, partial [Potarophytum riparium] Length = 172 Score = 58.2 bits (139), Expect = 6e-06 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY*NCAI 711 M R +IN NFIDK +S+LANIL R+IPTTS EK+AFTYY + AI Sbjct: 1 MPRSRINGNFIDKTSSILANILLRIIPTTSGEKKAFTYYRDGAI 44 >ref|YP_003934292.1| hypothetical chloroplast RF34 [Monsonia speciosa] gi|300069307|gb|ADJ66427.1| hypothetical chloroplast RF34 [Monsonia speciosa] Length = 168 Score = 58.2 bits (139), Expect = 6e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 M R +INENFIDK S++ANIL R+IPTTS E+EAFTYY Sbjct: 1 MPRSRINENFIDKTFSIVANILLRIIPTTSGEREAFTYY 39 >ref|YP_784474.1| photosystem I assembly protein ycf3 [Piper cenocladum] gi|122164361|sp|Q06GQ9.1|YCF3_PIPCE RecName: Full=Photosystem I assembly protein Ycf3 gi|112253752|gb|ABI14473.1| photosystem I assembly protein ycf3 [Piper cenocladum] Length = 168 Score = 58.2 bits (139), Expect = 6e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 M R QIN NFIDK S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MPRSQINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYY 39 >ref|YP_008081366.1| photosystem I assembly protein Ycf3 (chloroplast) [Tetracentron sinense] gi|479279204|gb|AGJ72058.1| photosystem I assembly protein Ycf3 (chloroplast) [Tetracentron sinense] Length = 168 Score = 57.8 bits (138), Expect = 7e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 M R +IN NFIDK +S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MPRSRINGNFIDKTSSIVANILLRIIPTTSGEKEAFTYY 39 >gb|AAZ03961.1| Ycf3 [Acorus americanus] Length = 170 Score = 57.8 bits (138), Expect = 7e-06 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY*NCAI 711 M R +IN NFIDK ++++ANIL R+IPTTS EKEAFTYY + AI Sbjct: 1 MPRSRINANFIDKTSTIVANILLRIIPTTSGEKEAFTYYRDGAI 44 >ref|YP_053156.1| photosystem I assembly protein Ycf3 [Nymphaea alba] gi|121720614|ref|YP_001001535.1| photosystem I assembly protein ycf3 [Nuphar advena] gi|68053164|sp|Q6EW47.1|YCF3_NYMAL RecName: Full=Photosystem I assembly protein Ycf3 gi|171769532|sp|A1XFV6.1|YCF3_NUPAD RecName: Full=Photosystem I assembly protein Ycf3 gi|50250328|emb|CAF28594.1| ycf3 [Nymphaea alba] gi|84682205|gb|ABC60459.1| photosystem I assembly protein ycf3 [Nuphar advena] Length = 168 Score = 57.8 bits (138), Expect = 7e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 580 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYY 696 M R +IN NFIDK +S++ANIL R+IPTTS EKEAFTYY Sbjct: 1 MPRSRINGNFIDKTSSIVANILLRIIPTTSGEKEAFTYY 39