BLASTX nr result
ID: Akebia23_contig00000672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00000672 (1012 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36894.1| hypothetical protein MIMGU_mgv1a015751mg [Mimulus... 106 1e-20 ref|XP_006401371.1| hypothetical protein EUTSA_v10014935mg [Eutr... 106 1e-20 ref|XP_006385788.1| hypothetical protein POPTR_0003s13600g [Popu... 106 1e-20 gb|EMT27803.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops ... 106 1e-20 gb|EMT16862.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops ... 106 1e-20 gb|EMS65000.1| Ubiquitin-conjugating enzyme E2-17 kDa [Triticum ... 106 1e-20 gb|AFY06649.1| ubiquitin conjugating enzyme, partial [Carica pap... 106 1e-20 ref|XP_003564489.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 106 1e-20 gb|ACN39809.1| unknown [Picea sitchensis] 106 1e-20 ref|XP_002303624.1| ubiquitin conjugating-like enzyme family pro... 106 1e-20 ref|NP_001235332.1| uncharacterized protein LOC100305945 [Glycin... 106 1e-20 gb|AAY29571.1| immature spike ubiquitin-conjugating enzyme 2 [Tr... 106 1e-20 gb|EYU19615.1| hypothetical protein MIMGU_mgv1a015722mg [Mimulus... 105 3e-20 gb|EXC02953.1| Ubiquitin-conjugating enzyme E2 10 [Morus notabilis] 105 3e-20 gb|EXB72469.1| Ubiquitin-conjugating enzyme E2 10 [Morus notabilis] 105 3e-20 ref|NP_001234247.1| ubiquitin-conjugating enzyme E2-17 kDa [Sola... 105 3e-20 ref|XP_006343894.1| PREDICTED: SUMO-conjugating enzyme UBC9-like... 105 3e-20 gb|AGZ90160.1| ubiquitin-conjugating enzyme E2 [Litsea cubeba] 105 3e-20 ref|XP_006452759.1| hypothetical protein CICLE_v10009806mg [Citr... 105 3e-20 ref|XP_006452758.1| hypothetical protein CICLE_v10009806mg [Citr... 105 3e-20 >gb|EYU36894.1| hypothetical protein MIMGU_mgv1a015751mg [Mimulus guttatus] Length = 147 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 98 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 147 >ref|XP_006401371.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|567178671|ref|XP_006401372.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|567178674|ref|XP_006401373.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|557102461|gb|ESQ42824.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|557102462|gb|ESQ42825.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] gi|557102463|gb|ESQ42826.1| hypothetical protein EUTSA_v10014935mg [Eutrema salsugineum] Length = 148 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >ref|XP_006385788.1| hypothetical protein POPTR_0003s13600g [Populus trichocarpa] gi|550343111|gb|ERP63585.1| hypothetical protein POPTR_0003s13600g [Populus trichocarpa] Length = 107 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 58 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 107 >gb|EMT27803.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops tauschii] Length = 162 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 113 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 162 >gb|EMT16862.1| Ubiquitin-conjugating enzyme E2-17 kDa [Aegilops tauschii] Length = 148 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >gb|EMS65000.1| Ubiquitin-conjugating enzyme E2-17 kDa [Triticum urartu] Length = 217 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 168 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 217 >gb|AFY06649.1| ubiquitin conjugating enzyme, partial [Carica papaya] Length = 124 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 75 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 124 >ref|XP_003564489.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Brachypodium distachyon] gi|357125621|ref|XP_003564490.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Brachypodium distachyon] gi|357125623|ref|XP_003564491.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 3 [Brachypodium distachyon] gi|357133250|ref|XP_003568239.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Brachypodium distachyon] gi|357133252|ref|XP_003568240.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Brachypodium distachyon] gi|357133254|ref|XP_003568241.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 3 [Brachypodium distachyon] Length = 148 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >gb|ACN39809.1| unknown [Picea sitchensis] Length = 148 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >ref|XP_002303624.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|118487400|gb|ABK95528.1| unknown [Populus trichocarpa] gi|222841056|gb|EEE78603.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|564587035|gb|AHB86964.1| ubiquitin conjugating enzyme 9 [Sedum alfredii] Length = 148 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >ref|NP_001235332.1| uncharacterized protein LOC100305945 [Glycine max] gi|224058407|ref|XP_002299494.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|225426040|ref|XP_002274274.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Vitis vinifera] gi|225462705|ref|XP_002267153.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Vitis vinifera] gi|357512493|ref|XP_003626535.1| Ubiquitin carrier protein [Medicago truncatula] gi|359474069|ref|XP_003631397.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Vitis vinifera] gi|470141980|ref|XP_004306700.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Fragaria vesca subsp. vesca] gi|567893840|ref|XP_006439408.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|567893842|ref|XP_006439409.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|567893844|ref|XP_006439410.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|568845141|ref|XP_006476436.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform X1 [Citrus sinensis] gi|568845143|ref|XP_006476437.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform X2 [Citrus sinensis] gi|571560602|ref|XP_006604881.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Glycine max] gi|586723595|ref|XP_006849364.1| hypothetical protein AMTR_s00158p00046520 [Amborella trichopoda] gi|590678887|ref|XP_007040427.1| Ubiquitin carrier protein isoform 1 [Theobroma cacao] gi|590678891|ref|XP_007040428.1| Ubiquitin carrier protein isoform 2, partial [Theobroma cacao] gi|593693504|ref|XP_007147273.1| hypothetical protein PHAVU_006G110100g [Phaseolus vulgaris] gi|118485959|gb|ABK94824.1| unknown [Populus trichocarpa] gi|217075220|gb|ACJ85970.1| unknown [Medicago truncatula] gi|222846752|gb|EEE84299.1| ubiquitin conjugating-like enzyme family protein [Populus trichocarpa] gi|224812550|gb|ACN64930.1| ubiquitin-conjugating enzyme E2 [Vigna radiata] gi|255627069|gb|ACU13879.1| unknown [Glycine max] gi|297742298|emb|CBI34447.3| unnamed protein product [Vitis vinifera] gi|302143696|emb|CBI22557.3| unnamed protein product [Vitis vinifera] gi|355501550|gb|AES82753.1| Ubiquitin carrier protein [Medicago truncatula] gi|388499224|gb|AFK37678.1| unknown [Medicago truncatula] gi|388515339|gb|AFK45731.1| unknown [Medicago truncatula] gi|508777672|gb|EOY24928.1| Ubiquitin carrier protein isoform 1 [Theobroma cacao] gi|508777673|gb|EOY24929.1| Ubiquitin carrier protein isoform 2, partial [Theobroma cacao] gi|548852911|gb|ERN10945.1| hypothetical protein AMTR_s00158p00046520 [Amborella trichopoda] gi|557541670|gb|ESR52648.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|557541671|gb|ESR52649.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|557541672|gb|ESR52650.1| hypothetical protein CICLE_v10022710mg [Citrus clementina] gi|561020496|gb|ESW19267.1| hypothetical protein PHAVU_006G110100g [Phaseolus vulgaris] gi|604306132|gb|EYU25189.1| hypothetical protein MIMGU_mgv1a015707mg [Mimulus guttatus] gi|604306133|gb|EYU25190.1| hypothetical protein MIMGU_mgv1a015707mg [Mimulus guttatus] Length = 148 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >gb|AAY29571.1| immature spike ubiquitin-conjugating enzyme 2 [Triticum aestivum] Length = 148 Score = 106 bits (265), Expect = 1e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 148 >gb|EYU19615.1| hypothetical protein MIMGU_mgv1a015722mg [Mimulus guttatus] Length = 148 Score = 105 bits (262), Expect = 3e-20 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAMG 148 >gb|EXC02953.1| Ubiquitin-conjugating enzyme E2 10 [Morus notabilis] Length = 167 Score = 105 bits (262), Expect = 3e-20 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 118 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAMG 167 >gb|EXB72469.1| Ubiquitin-conjugating enzyme E2 10 [Morus notabilis] Length = 168 Score = 105 bits (262), Expect = 3e-20 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 119 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAMG 168 >ref|NP_001234247.1| ubiquitin-conjugating enzyme E2-17 kDa [Solanum lycopersicum] gi|568214689|ref|NP_001275127.1| ubiquitin-conjugating enzyme E2-like protein [Solanum tuberosum] gi|460389580|ref|XP_004240429.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 1 [Solanum lycopersicum] gi|460389582|ref|XP_004240430.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 2 [Solanum lycopersicum] gi|460389584|ref|XP_004240431.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 3 [Solanum lycopersicum] gi|460389586|ref|XP_004240432.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform 4 [Solanum lycopersicum] gi|565354369|ref|XP_006344083.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like [Solanum tuberosum] gi|565368518|ref|XP_006350891.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa isoform X1 [Solanum tuberosum] gi|464981|sp|P35135.1|UBC4_SOLLC RecName: Full=Ubiquitin-conjugating enzyme E2-17 kDa; AltName: Full=Ubiquitin carrier protein; AltName: Full=Ubiquitin-protein ligase gi|388207|gb|AAA34125.1| ubiquitin carrier protein [Solanum lycopersicum] gi|83283973|gb|ABC01894.1| ubiquitin-conjugating enzyme E2-like protein [Solanum tuberosum] gi|213494485|gb|ACJ48964.1| ubiquitin conjugating enzyme [Solanum lycopersicum] Length = 148 Score = 105 bits (262), Expect = 3e-20 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148 >ref|XP_006343894.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Solanum tuberosum] Length = 148 Score = 105 bits (262), Expect = 3e-20 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAMG 148 >gb|AGZ90160.1| ubiquitin-conjugating enzyme E2 [Litsea cubeba] Length = 148 Score = 105 bits (262), Expect = 3e-20 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAMG 148 >ref|XP_006452759.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] gi|567921508|ref|XP_006452760.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] gi|568841647|ref|XP_006474769.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa-like isoform X1 [Citrus sinensis] gi|557555985|gb|ESR65999.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] gi|557555986|gb|ESR66000.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] Length = 148 Score = 105 bits (262), Expect = 3e-20 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148 >ref|XP_006452758.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] gi|557555984|gb|ESR65998.1| hypothetical protein CICLE_v10009806mg [Citrus clementina] Length = 137 Score = 105 bits (262), Expect = 3e-20 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = -2 Query: 159 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG 10 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDR+KYETTARSWTQKYAMG Sbjct: 88 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAMG 137