BLASTX nr result
ID: Akebia23_contig00000567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00000567 (212 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272395.1| PREDICTED: uncharacterized protein LOC100247... 61 1e-07 ref|XP_002304781.2| hypothetical protein POPTR_0003s20040g [Popu... 59 9e-07 ref|XP_004299920.1| PREDICTED: uncharacterized protein LOC101305... 58 2e-06 ref|XP_002513102.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002272395.1| PREDICTED: uncharacterized protein LOC100247519 [Vitis vinifera] Length = 1062 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -3 Query: 210 LVEAFETVMPIPKYESHLQHTTNAFAHARPIQACS 106 LVEAFETV+P+PKYE+ ++HT+ AFAH RPIQACS Sbjct: 1028 LVEAFETVLPLPKYETRIRHTSAAFAHPRPIQACS 1062 >ref|XP_002304781.2| hypothetical protein POPTR_0003s20040g [Populus trichocarpa] gi|550343589|gb|EEE79760.2| hypothetical protein POPTR_0003s20040g [Populus trichocarpa] Length = 979 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 210 LVEAFETVMPIPKYESHLQHTTNAFAHARPIQACS 106 LVEAFE V+P PKYE+H++HT+ F+H RPIQACS Sbjct: 945 LVEAFEKVLPTPKYETHIRHTSATFSHTRPIQACS 979 >ref|XP_004299920.1| PREDICTED: uncharacterized protein LOC101305177 [Fragaria vesca subsp. vesca] Length = 902 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 210 LVEAFETVMPIPKYESHLQHTTNAFAHARPIQACS 106 LVEAFE VMP PKYE L+H++ AF+HARP+QACS Sbjct: 868 LVEAFEKVMPAPKYEPRLKHSSTAFSHARPMQACS 902 >ref|XP_002513102.1| conserved hypothetical protein [Ricinus communis] gi|223548113|gb|EEF49605.1| conserved hypothetical protein [Ricinus communis] Length = 836 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -3 Query: 210 LVEAFETVMPIPKYESHLQHTTNAFAHARPIQACS 106 LVEAFE V+P+PKYE+H ++T+ AF H RP+QACS Sbjct: 802 LVEAFEAVLPVPKYETHFRNTSAAFTHTRPMQACS 836