BLASTX nr result
ID: Akebia22_contig00048701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00048701 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 94 2e-17 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 94 2e-17 gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis... 92 6e-17 ref|XP_006695025.1| 40S ribosomal protein S28-like protein [Chae... 92 6e-17 gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 92 7e-17 gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis A... 92 7e-17 gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 92 7e-17 gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia... 92 7e-17 gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destr... 92 7e-17 ref|XP_003664442.1| hypothetical protein MYCTH_36979, partial [M... 92 7e-17 ref|XP_003650823.1| 40S ribosomal protein S28 [Thielavia terrest... 92 7e-17 ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 92 7e-17 ref|XP_001903978.1| hypothetical protein [Podospora anserina S m... 92 7e-17 ref|XP_001561242.1| 40S ribosomal protein S28 [Botryotinia fucke... 92 7e-17 emb|CCX32541.1| Similar to 40S ribosomal protein S28; acc. no. Q... 91 2e-16 ref|XP_006668816.1| 40S ribosomal protein S28 [Cordyceps militar... 91 2e-16 ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fi... 90 4e-16 ref|XP_381438.1| hypothetical protein FG01262.1 [Fusarium gramin... 90 4e-16 gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii A... 90 4e-16 gb|EQB45990.1| ThiS family protein [Colletotrichum gloeosporioid... 90 4e-16 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 94.0 bits (232), Expect = 2e-17 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] Length = 68 Score = 94.0 bits (232), Expect = 2e-17 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 92.4 bits (228), Expect = 6e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGV+QVRVEFMDDTTRSIIRNVKGPVRENDI Sbjct: 8 VKLVKVTRVLGRTGSRGGVSQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >ref|XP_006695025.1| 40S ribosomal protein S28-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340939518|gb|EGS20140.1| 40S ribosomal protein S28-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 68 Score = 92.4 bits (228), Expect = 6e-17 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VK VKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI Sbjct: 8 VKFVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] Length = 68 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botryotinia fuckeliana BcDW1] Length = 114 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 54 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 100 >gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia compniacensis UAMH 10762] Length = 68 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] Length = 68 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_003664442.1| hypothetical protein MYCTH_36979, partial [Myceliophthora thermophila ATCC 42464] gi|347011712|gb|AEO59197.1| hypothetical protein MYCTH_36979, partial [Myceliophthora thermophila ATCC 42464] Length = 64 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 7 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 53 >ref|XP_003650823.1| 40S ribosomal protein S28 [Thielavia terrestris NRRL 8126] gi|346998084|gb|AEO64487.1| hypothetical protein THITE_2110661, partial [Thielavia terrestris NRRL 8126] Length = 67 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] Length = 68 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_001903978.1| hypothetical protein [Podospora anserina S mat+] gi|170937097|emb|CAP61755.1| unnamed protein product [Podospora anserina S mat+] Length = 68 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_001561242.1| 40S ribosomal protein S28 [Botryotinia fuckeliana B05.10] gi|347829972|emb|CCD45669.1| hypothetical protein BofuT4P34000010001 [Botryotinia fuckeliana T4] Length = 68 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >emb|CCX32541.1| Similar to 40S ribosomal protein S28; acc. no. Q10421 [Pyronema omphalodes CBS 100304] Length = 68 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKV +VLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI Sbjct: 8 VKLVKVIKVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >ref|XP_006668816.1| 40S ribosomal protein S28 [Cordyceps militaris CM01] gi|346325733|gb|EGX95330.1| 40S ribosomal protein S28 [Cordyceps militaris CM01] Length = 68 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVT+V+GRTGSRGGVTQVRVEFMDD+TRSIIRNVKGPVRENDI Sbjct: 8 VKLVKVTKVIGRTGSRGGVTQVRVEFMDDSTRSIIRNVKGPVRENDI 54 >ref|XP_007600844.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] gi|588893325|gb|EXF75473.1| 40S ribosomal protein S28 [Colletotrichum fioriniae PJ7] Length = 68 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDETRSIIRNVKGPVREDDI 54 >ref|XP_381438.1| hypothetical protein FG01262.1 [Fusarium graminearum PH-1] Length = 171 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii ATCC 58251] Length = 68 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >gb|EQB45990.1| ThiS family protein [Colletotrichum gloeosporioides Cg-14] Length = 162 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 335 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 195 VKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVRE+DI Sbjct: 8 VKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54