BLASTX nr result
ID: Akebia22_contig00023037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00023037 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293372.1| PREDICTED: disease resistance RPP13-like pro... 57 3e-06 gb|EXC35428.1| Disease resistance RPP13-like protein 4 [Morus no... 55 8e-06 ref|XP_007203313.1| hypothetical protein PRUPE_ppa001346mg [Prun... 55 8e-06 >ref|XP_004293372.1| PREDICTED: disease resistance RPP13-like protein 4-like [Fragaria vesca subsp. vesca] Length = 867 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/56 (46%), Positives = 34/56 (60%) Frame = -2 Query: 201 WKLEVLVLSNLDELEEEWPRMQKAMPFLRFLTVDKCPKFKALPFDLDEDGSGTWRK 34 WK+E L L L L+ +W +QKA+P LR++ + KCPK K P D D G WRK Sbjct: 813 WKIEGLYLKLLHMLDVDWDDLQKALPVLRYMEISKCPKLKNFPID-DVFKGGVWRK 867 >gb|EXC35428.1| Disease resistance RPP13-like protein 4 [Morus notabilis] Length = 817 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = -2 Query: 249 FFGDDEDSXXXXXXTVWKLEVLVLSNLDELEEEWPRMQKAMPFLRFLTVDKCPKFKALPF 70 F+GDD+ VW++E L+L +L + EEEWPR+ + MP LR ++ CP+ + F Sbjct: 749 FWGDDDT--------VWRIEGLMLESLSDFEEEWPRVTQVMPLLRVVSACWCPEL--VSF 798 Query: 69 DLDEDG--SGTWRKE 31 +++ G G W+KE Sbjct: 799 TVEDIGFRGGVWKKE 813 >ref|XP_007203313.1| hypothetical protein PRUPE_ppa001346mg [Prunus persica] gi|462398844|gb|EMJ04512.1| hypothetical protein PRUPE_ppa001346mg [Prunus persica] Length = 848 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/58 (41%), Positives = 35/58 (60%) Frame = -2 Query: 204 VWKLEVLVLSNLDELEEEWPRMQKAMPFLRFLTVDKCPKFKALPFDLDEDGSGTWRKE 31 VWK+E L L +L + EEEW R+Q+ MP LR + V CP+ + P + G W++E Sbjct: 787 VWKIEGLRLKSLSDFEEEWERLQRVMPALRVVDVSWCPELMSFPIENVGFKGGVWKEE 844