BLASTX nr result
ID: Akebia22_contig00022467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00022467 (841 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844374.1| hypothetical protein AMTR_s00142p00070390 [A... 66 1e-08 >ref|XP_006844374.1| hypothetical protein AMTR_s00142p00070390 [Amborella trichopoda] gi|548846820|gb|ERN06049.1| hypothetical protein AMTR_s00142p00070390 [Amborella trichopoda] Length = 444 Score = 66.2 bits (160), Expect = 1e-08 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +2 Query: 719 SDNPHKDVQTLLVGYSKESESEAQLKLILP*IVSSFGSHKS 841 SD+PHKDVQ LL YSKE ESEAQLKL+LP IVSSFG HKS Sbjct: 276 SDDPHKDVQALLSKYSKEPESEAQLKLLLPQIVSSFGKHKS 316