BLASTX nr result
ID: Akebia22_contig00010038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00010038 (915 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277652.2| PREDICTED: UPF0505 protein C16orf62 homolog ... 67 1e-08 emb|CBI26668.3| unnamed protein product [Vitis vinifera] 67 1e-08 ref|XP_004169203.1| PREDICTED: UPF0505 protein-like, partial [Cu... 66 2e-08 ref|XP_004139792.1| PREDICTED: UPF0505 protein C16orf62 homolog ... 66 2e-08 ref|XP_006475133.1| PREDICTED: UPF0505 protein C16orf62-like [Ci... 64 8e-08 ref|XP_006452424.1| hypothetical protein CICLE_v10007388mg [Citr... 64 8e-08 gb|EXB66322.1| hypothetical protein L484_008062 [Morus notabilis] 64 1e-07 emb|CAN66283.1| hypothetical protein VITISV_003049 [Vitis vinifera] 63 1e-07 ref|XP_002529445.1| esophageal cancer associated protein, putati... 62 3e-07 ref|XP_007214652.1| hypothetical protein PRUPE_ppa002061mg [Prun... 60 9e-07 ref|XP_006306720.1| hypothetical protein CARUB_v10008246mg [Caps... 58 5e-06 ref|XP_006306719.1| hypothetical protein CARUB_v10008246mg [Caps... 58 5e-06 ref|XP_007020755.1| Uncharacterized protein isoform 3 [Theobroma... 58 6e-06 ref|XP_007020754.1| Uncharacterized protein isoform 2 [Theobroma... 58 6e-06 ref|XP_007020753.1| Uncharacterized protein isoform 1 [Theobroma... 58 6e-06 ref|XP_002298824.1| hypothetical protein POPTR_0001s36680g [Popu... 57 8e-06 >ref|XP_002277652.2| PREDICTED: UPF0505 protein C16orf62 homolog [Vitis vinifera] Length = 920 Score = 67.0 bits (162), Expect = 1e-08 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLAIK---DAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHS + LAIK +A K +SFVKSCI SEVTIPSIS C K +NLYLET EV Sbjct: 648 ETLVHSCNCLAIKAMKEAKKHISFVKSCIAFSEVTIPSISACPKQLNLYLETAEV 702 >emb|CBI26668.3| unnamed protein product [Vitis vinifera] Length = 810 Score = 67.0 bits (162), Expect = 1e-08 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLAIK---DAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHS + LAIK +A K +SFVKSCI SEVTIPSIS C K +NLYLET EV Sbjct: 538 ETLVHSCNCLAIKAMKEAKKHISFVKSCIAFSEVTIPSISACPKQLNLYLETAEV 592 >ref|XP_004169203.1| PREDICTED: UPF0505 protein-like, partial [Cucumis sativus] Length = 369 Score = 65.9 bits (159), Expect = 2e-08 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYL---AIKDAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHSS+ L A+KDA K V+FVK+CI SEVT+PSIST IK NLYLET EV Sbjct: 103 ETLVHSSNGLTVKALKDAKKNVNFVKACIAFSEVTLPSISTQIKQFNLYLETAEV 157 >ref|XP_004139792.1| PREDICTED: UPF0505 protein C16orf62 homolog [Cucumis sativus] Length = 783 Score = 65.9 bits (159), Expect = 2e-08 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYL---AIKDAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHSS+ L A+KDA K V+FVK+CI SEVT+PSIST IK NLYLET EV Sbjct: 517 ETLVHSSNGLTVKALKDAKKNVNFVKACIAFSEVTLPSISTQIKQFNLYLETAEV 571 >ref|XP_006475133.1| PREDICTED: UPF0505 protein C16orf62-like [Citrus sinensis] Length = 1071 Score = 63.9 bits (154), Expect = 8e-08 Identities = 35/55 (63%), Positives = 42/55 (76%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLA---IKDAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHSS++LA +KD K +SFVKSCI SEVTIPSIS I+ +NLY+ET EV Sbjct: 711 ETLVHSSNHLATKALKDGRKHLSFVKSCIAFSEVTIPSISDHIRQLNLYIETSEV 765 >ref|XP_006452424.1| hypothetical protein CICLE_v10007388mg [Citrus clementina] gi|557555650|gb|ESR65664.1| hypothetical protein CICLE_v10007388mg [Citrus clementina] Length = 921 Score = 63.9 bits (154), Expect = 8e-08 Identities = 35/55 (63%), Positives = 42/55 (76%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLA---IKDAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHSS++LA +KD K +SFVKSCI SEVTIPSIS I+ +NLY+ET EV Sbjct: 651 ETLVHSSNHLATKALKDGRKHLSFVKSCIAFSEVTIPSISDHIRQLNLYIETSEV 705 >gb|EXB66322.1| hypothetical protein L484_008062 [Morus notabilis] Length = 949 Score = 63.5 bits (153), Expect = 1e-07 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLAIK---DAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E+L+HSS++LA+K D +K SF+KSCI EVT+PSIS+ I +NLYLET EV Sbjct: 678 EILIHSSNFLAVKALKDGSKHHSFIKSCIAFGEVTLPSISSQISQLNLYLETAEV 732 >emb|CAN66283.1| hypothetical protein VITISV_003049 [Vitis vinifera] Length = 510 Score = 63.2 bits (152), Expect = 1e-07 Identities = 36/55 (65%), Positives = 40/55 (72%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLAIK---DAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHS + LAIK +A K +SFVKSCI SEVTIPSIS K +NLYLET EV Sbjct: 238 ETLVHSCNCLAIKAMKEAKKHISFVKSCIAFSEVTIPSISAXPKQLNLYLETAEV 292 >ref|XP_002529445.1| esophageal cancer associated protein, putative [Ricinus communis] gi|223531061|gb|EEF32911.1| esophageal cancer associated protein, putative [Ricinus communis] Length = 925 Score = 62.0 bits (149), Expect = 3e-07 Identities = 32/55 (58%), Positives = 41/55 (74%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLA---IKDAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHSS+YLA +KD K ++ VKSC+ SEVTIPSI+ ++ +NLYLET EV Sbjct: 654 ETLVHSSNYLATKALKDGKKHLTLVKSCLAFSEVTIPSIAAQVRQLNLYLETAEV 708 >ref|XP_007214652.1| hypothetical protein PRUPE_ppa002061mg [Prunus persica] gi|462410517|gb|EMJ15851.1| hypothetical protein PRUPE_ppa002061mg [Prunus persica] Length = 723 Score = 60.5 bits (145), Expect = 9e-07 Identities = 33/55 (60%), Positives = 40/55 (72%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLAIK---DAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E L+HSS+ LAIK D + + FVKSCI SEVT+PSIS I+ +NLYLET EV Sbjct: 549 ETLIHSSNCLAIKALKDGNRHLGFVKSCIAFSEVTLPSISPQIRQLNLYLETAEV 603 >ref|XP_006306720.1| hypothetical protein CARUB_v10008246mg [Capsella rubella] gi|482575431|gb|EOA39618.1| hypothetical protein CARUB_v10008246mg [Capsella rubella] Length = 917 Score = 58.2 bits (139), Expect = 5e-06 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLAIKD---AAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LV SS+ LA+K K ++FVKSC+ SEVTIPS+ST K +NLYLET EV Sbjct: 660 ETLVRSSNTLAVKALKAGKKHINFVKSCLAFSEVTIPSVSTPTKHLNLYLETAEV 714 >ref|XP_006306719.1| hypothetical protein CARUB_v10008246mg [Capsella rubella] gi|482575430|gb|EOA39617.1| hypothetical protein CARUB_v10008246mg [Capsella rubella] Length = 794 Score = 58.2 bits (139), Expect = 5e-06 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLAIKD---AAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LV SS+ LA+K K ++FVKSC+ SEVTIPS+ST K +NLYLET EV Sbjct: 505 ETLVRSSNTLAVKALKAGKKHINFVKSCLAFSEVTIPSVSTPTKHLNLYLETAEV 559 >ref|XP_007020755.1| Uncharacterized protein isoform 3 [Theobroma cacao] gi|508720383|gb|EOY12280.1| Uncharacterized protein isoform 3 [Theobroma cacao] Length = 895 Score = 57.8 bits (138), Expect = 6e-06 Identities = 34/55 (61%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLA---IKDAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHSS+ LA +KD +SFVKSCI SEVTIPSI IK ++LYLET EV Sbjct: 652 EFLVHSSNCLATKALKDGKTHLSFVKSCIAFSEVTIPSILGHIKQLHLYLETAEV 706 >ref|XP_007020754.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508720382|gb|EOY12279.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 922 Score = 57.8 bits (138), Expect = 6e-06 Identities = 34/55 (61%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLA---IKDAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHSS+ LA +KD +SFVKSCI SEVTIPSI IK ++LYLET EV Sbjct: 652 EFLVHSSNCLATKALKDGKTHLSFVKSCIAFSEVTIPSILGHIKQLHLYLETAEV 706 >ref|XP_007020753.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508720381|gb|EOY12278.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 920 Score = 57.8 bits (138), Expect = 6e-06 Identities = 34/55 (61%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLA---IKDAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHSS+ LA +KD +SFVKSCI SEVTIPSI IK ++LYLET EV Sbjct: 650 EFLVHSSNCLATKALKDGKTHLSFVKSCIAFSEVTIPSILGHIKQLHLYLETAEV 704 >ref|XP_002298824.1| hypothetical protein POPTR_0001s36680g [Populus trichocarpa] gi|222846082|gb|EEE83629.1| hypothetical protein POPTR_0001s36680g [Populus trichocarpa] Length = 290 Score = 57.4 bits (137), Expect = 8e-06 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 3/55 (5%) Frame = +1 Query: 1 EVLVHSSDYLAIK---DAAKLVSFVKSCITISEVTIPSISTCIK*MNLYLETVEV 156 E LVHSS+ LAIK D K ++FVKSCI SEVTIPS+ + NLY+ET EV Sbjct: 26 ETLVHSSNCLAIKALKDGRKHLNFVKSCIAFSEVTIPSVLEHVVQFNLYIETAEV 80