BLASTX nr result
ID: Aconitum23_contig00045122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00045122 (454 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD35524.1| selenium-binding protein-like [Oryza sativa Japo... 165 1e-38 gb|EAZ37630.1| hypothetical protein OsJ_21964 [Oryza sativa Japo... 165 1e-38 ref|XP_010257783.1| PREDICTED: putative pentatricopeptide repeat... 164 3e-38 ref|XP_006656246.1| PREDICTED: putative pentatricopeptide repeat... 162 7e-38 gb|KHN44027.1| Putative pentatricopeptide repeat-containing prot... 161 2e-37 gb|KDO57236.1| hypothetical protein CISIN_1g006705mg [Citrus sin... 161 2e-37 ref|XP_006490046.1| PREDICTED: putative pentatricopeptide repeat... 161 2e-37 ref|XP_003518062.1| PREDICTED: putative pentatricopeptide repeat... 161 2e-37 gb|KQL11424.1| hypothetical protein SETIT_006121mg [Setaria ital... 161 2e-37 ref|XP_010057662.1| PREDICTED: putative pentatricopeptide repeat... 161 2e-37 gb|KCW90262.1| hypothetical protein EUGRSUZ_A02412 [Eucalyptus g... 161 2e-37 ref|XP_007145648.1| hypothetical protein PHAVU_007G256700g [Phas... 161 2e-37 ref|XP_004965888.1| PREDICTED: putative pentatricopeptide repeat... 161 2e-37 ref|XP_008240832.1| PREDICTED: putative pentatricopeptide repeat... 160 3e-37 gb|KOM34137.1| hypothetical protein LR48_Vigan02g028700 [Vigna a... 159 6e-37 ref|NP_187990.1| pentatricopeptide repeat-containing protein [Ar... 159 6e-37 ref|XP_014511377.1| PREDICTED: putative pentatricopeptide repeat... 159 8e-37 ref|XP_012570451.1| PREDICTED: putative pentatricopeptide repeat... 159 1e-36 ref|XP_010501153.1| PREDICTED: putative pentatricopeptide repeat... 159 1e-36 ref|XP_007203274.1| hypothetical protein PRUPE_ppa025467mg [Prun... 158 1e-36 >dbj|BAD35524.1| selenium-binding protein-like [Oryza sativa Japonica Group] gi|51090953|dbj|BAD35556.1| selenium-binding protein-like [Oryza sativa Japonica Group] Length = 615 Score = 165 bits (417), Expect = 1e-38 Identities = 76/94 (80%), Positives = 83/94 (88%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AG+V DLSCVLHDVDDEQKERMLL HSEKLAI FGL+ TP G+ IRV+KNLR+CVDCHNF Sbjct: 522 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMNTPPGLTIRVMKNLRICVDCHNF 581 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AKFVSKV EREISLRD NRFH + HG C+CGDYW Sbjct: 582 AKFVSKVYEREISLRDKNRFHLLTHGNCTCGDYW 615 >gb|EAZ37630.1| hypothetical protein OsJ_21964 [Oryza sativa Japonica Group] Length = 583 Score = 165 bits (417), Expect = 1e-38 Identities = 76/94 (80%), Positives = 83/94 (88%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AG+V DLSCVLHDVDDEQKERMLL HSEKLAI FGL+ TP G+ IRV+KNLR+CVDCHNF Sbjct: 490 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMNTPPGLTIRVMKNLRICVDCHNF 549 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AKFVSKV EREISLRD NRFH + HG C+CGDYW Sbjct: 550 AKFVSKVYEREISLRDKNRFHLLTHGNCTCGDYW 583 >ref|XP_010257783.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Nelumbo nucifera] Length = 782 Score = 164 bits (414), Expect = 3e-38 Identities = 72/94 (76%), Positives = 84/94 (89%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DLSCVLHDVD+EQKE++LL HSEKLA+AFGL+G P G+PIRV+KNLR+CVDCHNF Sbjct: 549 AGYVPDLSCVLHDVDEEQKEKILLGHSEKLALAFGLIGIPHGLPIRVVKNLRICVDCHNF 608 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AKF+SK RE+SLRD NRFH I+ G+CSCGDYW Sbjct: 609 AKFLSKAYRREVSLRDSNRFHHILGGICSCGDYW 642 >ref|XP_006656246.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Oryza brachyantha] Length = 438 Score = 162 bits (411), Expect = 7e-38 Identities = 74/94 (78%), Positives = 83/94 (88%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AG+V DLSCVLHDVDDEQKERMLL HSEKLAI FGL+ TP+G+ IR++KNLR+CVDCHNF Sbjct: 345 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMNTPSGLTIRIMKNLRICVDCHNF 404 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AKFVSKV REISLRD NRFH + HG C+CGDYW Sbjct: 405 AKFVSKVYGREISLRDKNRFHLLAHGNCTCGDYW 438 >gb|KHN44027.1| Putative pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 586 Score = 161 bits (408), Expect = 2e-37 Identities = 72/94 (76%), Positives = 83/94 (88%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DLSCVLHDVD+EQKE++LL+HSEKLA+ FGL+ TP +PIRVIKNLR+CVDCHNF Sbjct: 493 AGYVPDLSCVLHDVDEEQKEKILLSHSEKLALTFGLIATPESVPIRVIKNLRICVDCHNF 552 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AK+ SK+ RE+SLRD NRFHRIV G CSCGDYW Sbjct: 553 AKYTSKIYGREVSLRDKNRFHRIVGGKCSCGDYW 586 >gb|KDO57236.1| hypothetical protein CISIN_1g006705mg [Citrus sinensis] Length = 634 Score = 161 bits (408), Expect = 2e-37 Identities = 73/94 (77%), Positives = 83/94 (88%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV D+SCVL+DVD+EQKE++LL HSEKLA+ FGL+GTP G PIRVIKNLR+CVDCHNF Sbjct: 541 AGYVPDMSCVLYDVDEEQKEKVLLGHSEKLALTFGLIGTPEGAPIRVIKNLRICVDCHNF 600 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AKFVSKV R++SLRD NRFH IV G CSCGDYW Sbjct: 601 AKFVSKVYGRKVSLRDKNRFHHIVEGTCSCGDYW 634 >ref|XP_006490046.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like [Citrus sinensis] Length = 644 Score = 161 bits (408), Expect = 2e-37 Identities = 73/94 (77%), Positives = 83/94 (88%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV D+SCVL+DVD+EQKE++LL HSEKLA+ FGL+GTP G PIRVIKNLR+CVDCHNF Sbjct: 551 AGYVPDMSCVLYDVDEEQKEKVLLGHSEKLALTFGLIGTPEGAPIRVIKNLRICVDCHNF 610 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AKFVSKV R++SLRD NRFH IV G CSCGDYW Sbjct: 611 AKFVSKVYGRKVSLRDKNRFHHIVEGTCSCGDYW 644 >ref|XP_003518062.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like isoform X1 [Glycine max] gi|571440626|ref|XP_006575216.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial-like isoform X2 [Glycine max] gi|947123670|gb|KRH71876.1| hypothetical protein GLYMA_02G174500 [Glycine max] Length = 634 Score = 161 bits (408), Expect = 2e-37 Identities = 72/94 (76%), Positives = 83/94 (88%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DLSCVLHDVD+EQKE++LL+HSEKLA+ FGL+ TP +PIRVIKNLR+CVDCHNF Sbjct: 541 AGYVPDLSCVLHDVDEEQKEKILLSHSEKLALTFGLIATPESVPIRVIKNLRICVDCHNF 600 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AK+ SK+ RE+SLRD NRFHRIV G CSCGDYW Sbjct: 601 AKYTSKIYGREVSLRDKNRFHRIVGGKCSCGDYW 634 >gb|KQL11424.1| hypothetical protein SETIT_006121mg [Setaria italica] Length = 588 Score = 161 bits (407), Expect = 2e-37 Identities = 75/94 (79%), Positives = 82/94 (87%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AG+V DLSCVLHDVDDEQKERMLL HSEKLAI FGL+ TP+G+ IRV+KNLR+CVDCHNF Sbjct: 495 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMSTPSGLTIRVMKNLRICVDCHNF 554 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AKFVSKV REISLRD NRFH I G C+CGDYW Sbjct: 555 AKFVSKVYGREISLRDKNRFHIITDGTCTCGDYW 588 >ref|XP_010057662.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Eucalyptus grandis] Length = 647 Score = 161 bits (407), Expect = 2e-37 Identities = 71/93 (76%), Positives = 83/93 (89%) Frame = -3 Query: 395 GYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNFA 216 GYV DLSC HDVDDEQKE++LL HSEKLA+AFGL+G+ G+P+RVIKNLR+CVDCHNFA Sbjct: 555 GYVPDLSCAFHDVDDEQKEKILLGHSEKLALAFGLMGSAEGVPVRVIKNLRICVDCHNFA 614 Query: 215 KFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 KFVSK+ REISLRD NRFH IV+G+C+CGDYW Sbjct: 615 KFVSKLYAREISLRDKNRFHHIVNGICTCGDYW 647 >gb|KCW90262.1| hypothetical protein EUGRSUZ_A02412 [Eucalyptus grandis] Length = 692 Score = 161 bits (407), Expect = 2e-37 Identities = 71/93 (76%), Positives = 83/93 (89%) Frame = -3 Query: 395 GYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNFA 216 GYV DLSC HDVDDEQKE++LL HSEKLA+AFGL+G+ G+P+RVIKNLR+CVDCHNFA Sbjct: 494 GYVPDLSCAFHDVDDEQKEKILLGHSEKLALAFGLMGSAEGVPVRVIKNLRICVDCHNFA 553 Query: 215 KFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 KFVSK+ REISLRD NRFH IV+G+C+CGDYW Sbjct: 554 KFVSKLYAREISLRDKNRFHHIVNGICTCGDYW 586 >ref|XP_007145648.1| hypothetical protein PHAVU_007G256700g [Phaseolus vulgaris] gi|561018838|gb|ESW17642.1| hypothetical protein PHAVU_007G256700g [Phaseolus vulgaris] Length = 633 Score = 161 bits (407), Expect = 2e-37 Identities = 71/94 (75%), Positives = 84/94 (89%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DLSCVLHDVD+EQKE++LL+HSEKLA+ FGL+ +P +PIRVIKNLR+CVDCHNF Sbjct: 540 AGYVPDLSCVLHDVDEEQKEKILLSHSEKLALCFGLIASPESVPIRVIKNLRICVDCHNF 599 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AK++SK+ RE+SLRD NRFHRIV G CSCGDYW Sbjct: 600 AKYISKIYGREVSLRDKNRFHRIVGGKCSCGDYW 633 >ref|XP_004965888.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Setaria italica] gi|835967166|ref|XP_012701080.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Setaria italica] Length = 608 Score = 161 bits (407), Expect = 2e-37 Identities = 75/94 (79%), Positives = 82/94 (87%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AG+V DLSCVLHDVDDEQKERMLL HSEKLAI FGL+ TP+G+ IRV+KNLR+CVDCHNF Sbjct: 515 AGFVPDLSCVLHDVDDEQKERMLLGHSEKLAITFGLMSTPSGLTIRVMKNLRICVDCHNF 574 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AKFVSKV REISLRD NRFH I G C+CGDYW Sbjct: 575 AKFVSKVYGREISLRDKNRFHIITDGTCTCGDYW 608 >ref|XP_008240832.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Prunus mume] Length = 586 Score = 160 bits (406), Expect = 3e-37 Identities = 71/94 (75%), Positives = 83/94 (88%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DL CVL+DVD+EQKE++LL HSEK+A+AFGL+ TP G+P+RVIKNLR+CVDCHNF Sbjct: 493 AGYVPDLGCVLYDVDEEQKEKVLLGHSEKMALAFGLIATPEGVPVRVIKNLRICVDCHNF 552 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AKFVSK+ RE+SLRD NRFH IV G CSCGDYW Sbjct: 553 AKFVSKIYGREVSLRDKNRFHHIVGGTCSCGDYW 586 >gb|KOM34137.1| hypothetical protein LR48_Vigan02g028700 [Vigna angularis] Length = 586 Score = 159 bits (403), Expect = 6e-37 Identities = 71/94 (75%), Positives = 83/94 (88%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DLSCVLHDVD+EQKE++LL+HSEKLA+ FGL+ TP + IRVIKNLR+CVDCHNF Sbjct: 493 AGYVPDLSCVLHDVDEEQKEKILLSHSEKLALCFGLIATPESVTIRVIKNLRICVDCHNF 552 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AK++SK+ RE+SLRD NRFHRIV G CSCGDYW Sbjct: 553 AKYISKIYGREVSLRDKNRFHRIVGGKCSCGDYW 586 >ref|NP_187990.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273354|sp|Q9LIC3.1|PP227_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial; Flags: Precursor gi|9294022|dbj|BAB01925.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332641888|gb|AEE75409.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 628 Score = 159 bits (403), Expect = 6e-37 Identities = 73/94 (77%), Positives = 82/94 (87%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DLSCVL+DVD+EQKE+MLL HSEKLA+ FGL+ T GIPIRV KNLR+CVDCHNF Sbjct: 535 AGYVPDLSCVLYDVDEEQKEKMLLGHSEKLALTFGLIATGEGIPIRVFKNLRICVDCHNF 594 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AK SKV ERE+SLRD NRFH+IV G+CSCGDYW Sbjct: 595 AKIFSKVFEREVSLRDKNRFHQIVDGICSCGDYW 628 >ref|XP_014511377.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Vigna radiata var. radiata] Length = 633 Score = 159 bits (402), Expect = 8e-37 Identities = 71/94 (75%), Positives = 82/94 (87%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DLSCVLHDVD+EQKE++LL HSEKLA+ FGL+ TP + IRVIKNLR+CVDCHNF Sbjct: 540 AGYVPDLSCVLHDVDEEQKEKILLNHSEKLALCFGLISTPESVTIRVIKNLRICVDCHNF 599 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AK++SK+ RE+SLRD NRFHRIV G CSCGDYW Sbjct: 600 AKYISKIYGREVSLRDKNRFHRIVGGKCSCGDYW 633 >ref|XP_012570451.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Cicer arietinum] gi|828307208|ref|XP_012570452.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Cicer arietinum] Length = 616 Score = 159 bits (401), Expect = 1e-36 Identities = 72/93 (77%), Positives = 82/93 (88%) Frame = -3 Query: 395 GYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNFA 216 GYV DLSCVLHDVD+EQKE++LL HSEKLA++FGL+ TP PIRVIKNLR+CVDCHNFA Sbjct: 524 GYVPDLSCVLHDVDEEQKEKILLGHSEKLALSFGLIATPEHSPIRVIKNLRICVDCHNFA 583 Query: 215 KFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 K++SKV RE+SLRD NRFHRIV G CSCGDYW Sbjct: 584 KYISKVYRREVSLRDKNRFHRIVGGKCSCGDYW 616 >ref|XP_010501153.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Camelina sativa] Length = 634 Score = 159 bits (401), Expect = 1e-36 Identities = 72/94 (76%), Positives = 82/94 (87%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DLSCVL+DVD+EQKE+MLL HSEKLA+ FGL+ T GIPIRV KNLR+CVDCHNF Sbjct: 541 AGYVPDLSCVLYDVDEEQKEKMLLGHSEKLALTFGLIATGEGIPIRVFKNLRICVDCHNF 600 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AK SKV ERE++LRD NRFH+IV G+CSCGDYW Sbjct: 601 AKIFSKVFEREVTLRDKNRFHQIVRGICSCGDYW 634 >ref|XP_007203274.1| hypothetical protein PRUPE_ppa025467mg [Prunus persica] gi|462398805|gb|EMJ04473.1| hypothetical protein PRUPE_ppa025467mg [Prunus persica] Length = 575 Score = 158 bits (400), Expect = 1e-36 Identities = 70/94 (74%), Positives = 82/94 (87%) Frame = -3 Query: 398 AGYVHDLSCVLHDVDDEQKERMLLTHSEKLAIAFGLLGTPAGIPIRVIKNLRVCVDCHNF 219 AGYV DL CVL+DVD+EQKE++LL HSEK+A+AFGL+ TP G+P+RVIKNLR+CVDCHNF Sbjct: 482 AGYVPDLGCVLYDVDEEQKEKVLLGHSEKMALAFGLIATPEGVPVRVIKNLRICVDCHNF 541 Query: 218 AKFVSKVCEREISLRDCNRFHRIVHGVCSCGDYW 117 AK VSK+ RE+SLRD NRFH IV G CSCGDYW Sbjct: 542 AKLVSKIYGREVSLRDKNRFHHIVGGTCSCGDYW 575