BLASTX nr result
ID: Aconitum23_contig00044315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00044315 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012442520.1| PREDICTED: uncharacterized protein LOC105767... 57 5e-06 >ref|XP_012442520.1| PREDICTED: uncharacterized protein LOC105767512 [Gossypium raimondii] gi|763743757|gb|KJB11256.1| hypothetical protein B456_001G249900 [Gossypium raimondii] Length = 505 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 97 FDKLDVRGDIFGLLMAHPLQPLVSLHHLDYVQ 2 F +LD+RGD +GLL AHPL PLVSLHHLDYVQ Sbjct: 284 FHQLDIRGDPYGLLSAHPLAPLVSLHHLDYVQ 315