BLASTX nr result
ID: Aconitum23_contig00044260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00044260 (388 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012481610.1| PREDICTED: cysteine proteinase inhibitor B [... 56 9e-06 gb|KJB28025.1| hypothetical protein B456_005G022500 [Gossypium r... 56 9e-06 gb|ACK87021.1| cysteine protease inhibitor [Gossypium hirsutum] 56 9e-06 gb|ABS52572.1| cysteine proteinase inhibitor [Gossypium hirsutum] 56 9e-06 >ref|XP_012481610.1| PREDICTED: cysteine proteinase inhibitor B [Gossypium raimondii] Length = 125 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -3 Query: 383 QVVAGLKYNLTINATQNNIPMLFDAVVYVKPWTNTKELLDFKPFTH 246 QVVAG+KY L I A Q + F++VV VKPW +K+LL+F P TH Sbjct: 80 QVVAGIKYYLKIKAMQGGVTKTFESVVLVKPWVQSKDLLNFSPSTH 125 >gb|KJB28025.1| hypothetical protein B456_005G022500 [Gossypium raimondii] Length = 113 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -3 Query: 383 QVVAGLKYNLTINATQNNIPMLFDAVVYVKPWTNTKELLDFKPFTH 246 QVVAG+KY L I A Q + F++VV VKPW +K+LL+F P TH Sbjct: 68 QVVAGIKYYLKIKAMQGGVTKTFESVVLVKPWVQSKDLLNFSPSTH 113 >gb|ACK87021.1| cysteine protease inhibitor [Gossypium hirsutum] Length = 119 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -3 Query: 383 QVVAGLKYNLTINATQNNIPMLFDAVVYVKPWTNTKELLDFKPFTH 246 QVVAG+KY L I A Q + F++VV VKPW +K+LL+F P TH Sbjct: 74 QVVAGIKYYLKIKAMQGGVTKTFESVVLVKPWVQSKDLLNFSPSTH 119 >gb|ABS52572.1| cysteine proteinase inhibitor [Gossypium hirsutum] Length = 125 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -3 Query: 383 QVVAGLKYNLTINATQNNIPMLFDAVVYVKPWTNTKELLDFKPFTH 246 QVVAG+KY L I A Q + F++VV VKPW +K+LL+F P TH Sbjct: 80 QVVAGIKYYLKIKAMQGGVTKTFESVVLVKPWVQSKDLLNFSPSTH 125