BLASTX nr result
ID: Aconitum23_contig00043761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00043761 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208966.1| hypothetical protein PRUPE_ppb019935mg [Prun... 57 4e-06 >ref|XP_007208966.1| hypothetical protein PRUPE_ppb019935mg [Prunus persica] gi|462404701|gb|EMJ10165.1| hypothetical protein PRUPE_ppb019935mg [Prunus persica] Length = 651 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/58 (41%), Positives = 38/58 (65%) Frame = -1 Query: 188 FKGQVFASVEEAKHCYREYGANKGFSVKIRTSYGKKRGSSEPTGMKFSCSREGRYIPK 15 + G VF ++EEA++ Y EYG +GF ++ R+S +R E T +F C+ EG+Y+PK Sbjct: 43 YSGMVFDTMEEARNYYEEYGRQEGFWIRTRSSSKTRRRLDEVTSRQFVCAHEGKYVPK 100