BLASTX nr result
ID: Aconitum23_contig00042908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00042908 (386 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010243081.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 ref|XP_008224684.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_007213091.1| hypothetical protein PRUPE_ppa025418mg, part... 79 1e-12 ref|XP_008782984.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_010929003.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 77 7e-12 ref|XP_010661440.1| PREDICTED: pentatricopeptide repeat-containi... 74 6e-11 ref|XP_009407923.1| PREDICTED: pentatricopeptide repeat-containi... 73 1e-10 ref|XP_011072200.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_010058006.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 gb|KCW75468.1| hypothetical protein EUGRSUZ_E04230 [Eucalyptus g... 70 6e-10 ref|XP_004295339.2| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 ref|XP_009795726.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_009600799.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 68 2e-09 ref|XP_009597127.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_006828822.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_002520828.1| pentatricopeptide repeat-containing protein,... 67 7e-09 gb|KRH36664.1| hypothetical protein GLYMA_09G017100 [Glycine max] 66 1e-08 gb|KRH36663.1| hypothetical protein GLYMA_09G017100 [Glycine max] 66 1e-08 gb|KHN40759.1| Pentatricopeptide repeat-containing protein [Glyc... 66 1e-08 ref|XP_003534752.2| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 >ref|XP_010243081.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nelumbo nucifera] Length = 666 Score = 84.0 bits (206), Expect = 4e-14 Identities = 42/63 (66%), Positives = 48/63 (76%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEIIYL*K 207 R++MK+ NVKKVPG+SQIEV NK +FF GDRSH Q KEI ML E L PQMKE+ YL Sbjct: 601 RKKMKERNVKKVPGFSQIEVRNKSRVFFVGDRSHPQVKEIYAMLLETLLPQMKEMGYLKD 660 Query: 206 NPS 198 NPS Sbjct: 661 NPS 663 >ref|XP_008224684.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Prunus mume] Length = 667 Score = 79.3 bits (194), Expect = 1e-12 Identities = 40/68 (58%), Positives = 51/68 (75%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEIIYL*K 207 R++MK+ VKKVPG+SQIEV + H+FF+GDRSH QA EI G+LQEKL PQ+ E+ Y K Sbjct: 595 RKKMKERRVKKVPGFSQIEVKGRSHIFFAGDRSHPQAAEIYGLLQEKLLPQICEMGYS-K 653 Query: 206 NPSANICS 183 S+ CS Sbjct: 654 GNSSFFCS 661 >ref|XP_007213091.1| hypothetical protein PRUPE_ppa025418mg, partial [Prunus persica] gi|462408956|gb|EMJ14290.1| hypothetical protein PRUPE_ppa025418mg, partial [Prunus persica] Length = 610 Score = 79.3 bits (194), Expect = 1e-12 Identities = 40/68 (58%), Positives = 51/68 (75%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEIIYL*K 207 R++MK+ VKKVPG+SQIEV + H+FF+GDRSH QA EI G+LQEKL PQ+ E+ Y K Sbjct: 538 RKKMKERRVKKVPGFSQIEVKGRSHIFFAGDRSHPQAAEIYGLLQEKLLPQICEMGYS-K 596 Query: 206 NPSANICS 183 S+ CS Sbjct: 597 GNSSFFCS 604 >ref|XP_008782984.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Phoenix dactylifera] Length = 671 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/58 (65%), Positives = 46/58 (79%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEIIYL 213 R+ MK+ VKKVPG+SQIEV + H+F+ GDRSH QAKEI GML+E L PQMKE+ YL Sbjct: 606 RKMMKEKKVKKVPGFSQIEVKMRNHVFYVGDRSHPQAKEIYGMLKEVLLPQMKEMEYL 663 >ref|XP_010929003.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g02750-like [Elaeis guineensis] Length = 670 Score = 76.6 bits (187), Expect = 7e-12 Identities = 37/58 (63%), Positives = 46/58 (79%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEIIYL 213 R+ M++ VKKVPG+SQIEV + H+F+ GDRSH QAKEI GML+E L PQMKE+ YL Sbjct: 605 RKVMREKKVKKVPGFSQIEVKMRNHVFYVGDRSHPQAKEIYGMLKEVLLPQMKEMEYL 662 >ref|XP_010661440.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial isoform X1 [Vitis vinifera] gi|297734691|emb|CBI16742.3| unnamed protein product [Vitis vinifera] Length = 674 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/57 (59%), Positives = 44/57 (77%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEIIY 216 R++MKD NV+KVPG+SQIEV K H FF+GD+SH Q +EI +L+EKL P M E+ Y Sbjct: 607 RKKMKDRNVRKVPGFSQIEVKGKCHAFFAGDKSHPQVEEIYELLREKLLPIMHEMGY 663 >ref|XP_009407923.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Musa acuminata subsp. malaccensis] Length = 607 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/55 (60%), Positives = 45/55 (81%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEI 222 R++MK+ VKKVPG SQIEV K H+FF+GDRSH +A+EI ML+E+L PQM+++ Sbjct: 543 RKKMKERKVKKVPGVSQIEVGKKNHVFFAGDRSHPEAREIYDMLREELLPQMEDM 597 >ref|XP_011072200.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Sesamum indicum] Length = 685 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/55 (60%), Positives = 43/55 (78%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEI 222 R++MK+ VKKVPG+SQIEV+ K H+F GDRSH + KEI +L EKL PQM++I Sbjct: 620 RKKMKEREVKKVPGFSQIEVNGKSHVFLVGDRSHSEMKEIYMLLHEKLLPQMQDI 674 >ref|XP_010058006.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like [Eucalyptus grandis] Length = 662 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/55 (54%), Positives = 44/55 (80%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEI 222 R++MK+ NV+KVPG+SQIEV+ K H+FF+GDRSH + + + +LQ+KL P M E+ Sbjct: 602 RKKMKEQNVRKVPGFSQIEVNGKSHVFFAGDRSHPEMERVYRLLQDKLMPLMLEM 656 >gb|KCW75468.1| hypothetical protein EUGRSUZ_E04230 [Eucalyptus grandis] Length = 593 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/55 (54%), Positives = 44/55 (80%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEI 222 R++MK+ NV+KVPG+SQIEV+ K H+FF+GDRSH + + + +LQ+KL P M E+ Sbjct: 533 RKKMKEQNVRKVPGFSQIEVNGKSHVFFAGDRSHPEMERVYRLLQDKLMPLMLEM 587 >ref|XP_004295339.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Fragaria vesca subsp. vesca] Length = 658 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEIIY 216 R++MK+ V KVPG+SQI+V + H+F++ DRSH QA EI G+LQEKL P M E+ Y Sbjct: 591 RKKMKERKVNKVPGFSQIQVKGRSHVFYARDRSHPQAAEIWGLLQEKLLPHMWEMRY 647 >ref|XP_009795726.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana sylvestris] Length = 656 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/56 (55%), Positives = 44/56 (78%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEII 219 R++MK+ NVKKVPG S+IEV+ K H+FF GD+SH + +EI +L+E L P M+E+I Sbjct: 601 RKKMKERNVKKVPGMSEIEVNGKNHIFFVGDKSHPEKEEIYMLLKENLLPLMQEMI 656 >ref|XP_009600799.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g02750-like, partial [Nicotiana tomentosiformis] Length = 477 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/56 (55%), Positives = 44/56 (78%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEII 219 R++MK+ NVKKVPG S+IEV+ K H+FF GD+SH + KEI +L++ L P M+E+I Sbjct: 422 RKKMKERNVKKVPGISEIEVNGKNHIFFVGDKSHPEKKEIYILLKDNLLPLMQEMI 477 >ref|XP_009597127.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Nicotiana tomentosiformis] Length = 658 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/56 (55%), Positives = 44/56 (78%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEII 219 R++MK+ NVKKVPG S+IEV+ K H+FF GD+SH + KEI +L++ L P M+E+I Sbjct: 603 RKKMKERNVKKVPGISEIEVNGKNHIFFVGDKSHPEKKEIYILLKDNLLPLMQEMI 658 >ref|XP_006828822.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Amborella trichopoda] gi|548833801|gb|ERM96238.1| hypothetical protein AMTR_s00001p00138570 [Amborella trichopoda] Length = 667 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEIIYL*K 207 RR M+D VKK YS+IEV N++H FF GDR H A+EI GML+E L P MKE+ Y+ K Sbjct: 604 RRLMRDKIVKKQGAYSEIEVRNRVHTFFVGDRVHPLAREIYGMLEEGLLPMMKEMGYMTK 663 >ref|XP_002520828.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539959|gb|EEF41537.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 656 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEIIY 216 R+ MK+ NVKK PG+SQIEV K H+FF DRSH Q +EI L EKL P M+E+ Y Sbjct: 589 RKEMKERNVKKEPGFSQIEVKGKSHVFFVRDRSHPQLEEIYLFLDEKLLPLMREMGY 645 >gb|KRH36664.1| hypothetical protein GLYMA_09G017100 [Glycine max] Length = 689 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/55 (50%), Positives = 42/55 (76%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEI 222 R+RM++ NVK++PGYSQI++ K H+F G+RSH Q +EI +LQ+ L P M+E+ Sbjct: 623 RKRMRERNVKRIPGYSQIQITGKNHVFVVGERSHPQIEEIYRLLQQNLQPLMREM 677 >gb|KRH36663.1| hypothetical protein GLYMA_09G017100 [Glycine max] Length = 793 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/55 (50%), Positives = 42/55 (76%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEI 222 R+RM++ NVK++PGYSQI++ K H+F G+RSH Q +EI +LQ+ L P M+E+ Sbjct: 727 RKRMRERNVKRIPGYSQIQITGKNHVFVVGERSHPQIEEIYRLLQQNLQPLMREM 781 >gb|KHN40759.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 579 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/55 (50%), Positives = 42/55 (76%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEI 222 R+RM++ NVK++PGYSQI++ K H+F G+RSH Q +EI +LQ+ L P M+E+ Sbjct: 513 RKRMRERNVKRIPGYSQIQITGKNHVFVVGERSHPQIEEIYRLLQQNLQPLMREM 567 >ref|XP_003534752.2| PREDICTED: pentatricopeptide repeat-containing protein At1g09410-like [Glycine max] Length = 672 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/55 (50%), Positives = 42/55 (76%) Frame = -1 Query: 386 RRRMKDMNVKKVPGYSQIEVDNKIHLFFSGDRSHDQAKEIRGMLQEKLAPQMKEI 222 R+RM++ NVK++PGYSQI++ K H+F G+RSH Q +EI +LQ+ L P M+E+ Sbjct: 606 RKRMRERNVKRIPGYSQIQITGKNHVFVVGERSHPQIEEIYRLLQQNLQPLMREM 660