BLASTX nr result
ID: Aconitum23_contig00042681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00042681 (387 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK24069.1| unknown [Picea sitchensis] 59 2e-06 ref|XP_008462310.1| PREDICTED: mitochondrial ubiquitin ligase ac... 58 3e-06 ref|XP_008462309.1| PREDICTED: mitochondrial ubiquitin ligase ac... 58 3e-06 >gb|ABK24069.1| unknown [Picea sitchensis] Length = 394 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/51 (43%), Positives = 34/51 (66%) Frame = -1 Query: 339 SMNIPNEQLCTMCRRRTQKSVGVPCKHVVCCGRCAHLSQQISEPECRYCKR 187 S N+P+ +LC +C R ++S +PC H VCC RCA L ++ S P+C C++ Sbjct: 333 SGNVPDGELCVVCLMRRRRSAFIPCGHHVCCSRCAQLVERDSNPKCPVCRQ 383 >ref|XP_008462310.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform X2 [Cucumis melo] Length = 331 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/51 (43%), Positives = 34/51 (66%) Frame = -1 Query: 339 SMNIPNEQLCTMCRRRTQKSVGVPCKHVVCCGRCAHLSQQISEPECRYCKR 187 S N+P+ QLC +C R ++S +PC H+VCC RCA ++ S P+C C++ Sbjct: 270 SSNVPDGQLCVICLMRRKRSAFIPCGHLVCCERCAVSVERDSSPKCPICRQ 320 >ref|XP_008462309.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform X1 [Cucumis melo] Length = 405 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/51 (43%), Positives = 34/51 (66%) Frame = -1 Query: 339 SMNIPNEQLCTMCRRRTQKSVGVPCKHVVCCGRCAHLSQQISEPECRYCKR 187 S N+P+ QLC +C R ++S +PC H+VCC RCA ++ S P+C C++ Sbjct: 344 SSNVPDGQLCVICLMRRKRSAFIPCGHLVCCERCAVSVERDSSPKCPICRQ 394