BLASTX nr result
ID: Aconitum23_contig00042642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00042642 (333 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310803.1| hypothetical protein POPTR_0007s12780g [Popu... 62 1e-07 >ref|XP_002310803.1| hypothetical protein POPTR_0007s12780g [Populus trichocarpa] gi|222853706|gb|EEE91253.1| hypothetical protein POPTR_0007s12780g [Populus trichocarpa] Length = 148 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = +2 Query: 122 KIMSRRFRFQRGSSIKLGRSNSSALVSEAISSESARFIRYERVSQSMRLPDE 277 +++ R FR +RGSSIK GRSNSS L+SE+ISSE R RYE +S SMR+ ++ Sbjct: 2 ELVCRSFRVERGSSIKFGRSNSSLLISESISSECTRVARYENLSASMRMSND 53