BLASTX nr result
ID: Aconitum23_contig00042594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00042594 (578 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74986.1| hypothetical protein VITISV_008771 [Vitis vinifera] 57 7e-06 >emb|CAN74986.1| hypothetical protein VITISV_008771 [Vitis vinifera] Length = 1971 Score = 57.0 bits (136), Expect = 7e-06 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -3 Query: 159 WVCSGIYGPCKWWQRDGFWQELRDIRYLWSGLWVMGGDFNAI 34 WV SG+YGP R+ FW+ELR IR LWS W +GGDFN I Sbjct: 409 WVFSGVYGPTLKRYRELFWEELRAIRRLWSDPWCIGGDFNLI 450