BLASTX nr result
ID: Aconitum23_contig00042559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00042559 (394 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010257956.1| PREDICTED: ultraviolet-B receptor UVR8 isofo... 80 8e-13 ref|XP_010257955.1| PREDICTED: RCC1 and BTB domain-containing pr... 80 8e-13 ref|XP_010257954.1| PREDICTED: ultraviolet-B receptor UVR8 isofo... 80 8e-13 gb|EMS67082.1| hypothetical protein TRIUR3_21947 [Triticum urartu] 78 2e-12 ref|XP_008230293.1| PREDICTED: ultraviolet-B receptor UVR8 [Prun... 77 7e-12 gb|EEE59463.1| hypothetical protein OsJ_11655 [Oryza sativa Japo... 77 7e-12 gb|EEC75699.1| hypothetical protein OsI_12517 [Oryza sativa Indi... 77 7e-12 gb|AAN08220.1| putative chromosome condensation regulator [Oryza... 77 7e-12 ref|XP_007217882.1| hypothetical protein PRUPE_ppa005069mg [Prun... 77 7e-12 ref|XP_008681309.1| PREDICTED: putative regulator of chromosome ... 76 1e-11 ref|NP_001159191.1| putative regulator of chromosome condensatio... 76 1e-11 ref|XP_002466845.1| hypothetical protein SORBIDRAFT_01g015100 [S... 76 1e-11 ref|XP_010099306.1| hypothetical protein L484_018168 [Morus nota... 75 1e-11 ref|XP_010938025.1| PREDICTED: ultraviolet-B receptor UVR8 [Elae... 75 1e-11 ref|XP_008794204.1| PREDICTED: ultraviolet-B receptor UVR8 [Phoe... 75 1e-11 ref|XP_006650287.1| PREDICTED: RCC1 and BTB domain-containing pr... 75 1e-11 ref|XP_011021075.1| PREDICTED: probable E3 ubiquitin-protein lig... 75 2e-11 ref|XP_009378258.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 75 2e-11 ref|XP_008379452.1| PREDICTED: ultraviolet-B receptor UVR8-like ... 75 2e-11 ref|XP_006373397.1| hypothetical protein POPTR_0017s13420g [Popu... 75 3e-11 >ref|XP_010257956.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X3 [Nelumbo nucifera] Length = 356 Score = 79.7 bits (195), Expect = 8e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYAKFLD+ PELVKIIQVSCGEYHTAAISENGEV Sbjct: 87 QGARVLNAYAKFLDEAPELVKIIQVSCGEYHTAAISENGEV 127 >ref|XP_010257955.1| PREDICTED: RCC1 and BTB domain-containing protein 2 isoform X2 [Nelumbo nucifera] Length = 358 Score = 79.7 bits (195), Expect = 8e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYAKFLD+ PELVKIIQVSCGEYHTAAISENGEV Sbjct: 89 QGARVLNAYAKFLDEAPELVKIIQVSCGEYHTAAISENGEV 129 >ref|XP_010257954.1| PREDICTED: ultraviolet-B receptor UVR8 isoform X1 [Nelumbo nucifera] Length = 476 Score = 79.7 bits (195), Expect = 8e-13 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYAKFLD+ PELVKIIQVSCGEYHTAAISENGEV Sbjct: 207 QGARVLNAYAKFLDEAPELVKIIQVSCGEYHTAAISENGEV 247 >gb|EMS67082.1| hypothetical protein TRIUR3_21947 [Triticum urartu] Length = 480 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYA+FLDDTPELVKI++VSCGEYH AAISENGEV Sbjct: 207 QGARVLNAYARFLDDTPELVKIVRVSCGEYHAAAISENGEV 247 >ref|XP_008230293.1| PREDICTED: ultraviolet-B receptor UVR8 [Prunus mume] Length = 478 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR +NAYAKFLDD PELVKI QVSCGEYHTAAISE GEV Sbjct: 209 QGARIINAYAKFLDDAPELVKITQVSCGEYHTAAISEKGEV 249 >gb|EEE59463.1| hypothetical protein OsJ_11655 [Oryza sativa Japonica Group] Length = 581 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYA+FLD+ PELVKI++VSCGEYHTAAISENGEV Sbjct: 309 QGARVLNAYARFLDEAPELVKIVRVSCGEYHTAAISENGEV 349 >gb|EEC75699.1| hypothetical protein OsI_12517 [Oryza sativa Indica Group] Length = 555 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYA+FLD+ PELVKI++VSCGEYHTAAISENGEV Sbjct: 283 QGARVLNAYARFLDEAPELVKIVRVSCGEYHTAAISENGEV 323 >gb|AAN08220.1| putative chromosome condensation regulator [Oryza sativa Japonica Group] gi|108709680|gb|ABF97475.1| regulator of chromosome condensation, putative, expressed [Oryza sativa Japonica Group] Length = 505 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYA+FLD+ PELVKI++VSCGEYHTAAISENGEV Sbjct: 233 QGARVLNAYARFLDEAPELVKIVRVSCGEYHTAAISENGEV 273 >ref|XP_007217882.1| hypothetical protein PRUPE_ppa005069mg [Prunus persica] gi|462414032|gb|EMJ19081.1| hypothetical protein PRUPE_ppa005069mg [Prunus persica] Length = 478 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR +NAYAKFLDD PELVKI QVSCGEYHTAAISE GEV Sbjct: 209 QGARIINAYAKFLDDAPELVKITQVSCGEYHTAAISEKGEV 249 >ref|XP_008681309.1| PREDICTED: putative regulator of chromosome condensation (RCC1) family protein isoform X2 [Zea mays] Length = 399 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYA+FLDD PE VKI++VSCGEYHTAAISENGEV Sbjct: 126 QGARVLNAYARFLDDAPEQVKIVRVSCGEYHTAAISENGEV 166 >ref|NP_001159191.1| putative regulator of chromosome condensation (RCC1) family protein [Zea mays] gi|670360679|ref|XP_008681305.1| PREDICTED: putative regulator of chromosome condensation (RCC1) family protein isoform X1 [Zea mays] gi|223942555|gb|ACN25361.1| unknown [Zea mays] gi|414871691|tpg|DAA50248.1| TPA: putative regulator of chromosome condensation (RCC1) family protein [Zea mays] Length = 480 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYA+FLDD PE VKI++VSCGEYHTAAISENGEV Sbjct: 207 QGARVLNAYARFLDDAPEQVKIVRVSCGEYHTAAISENGEV 247 >ref|XP_002466845.1| hypothetical protein SORBIDRAFT_01g015100 [Sorghum bicolor] gi|241920699|gb|EER93843.1| hypothetical protein SORBIDRAFT_01g015100 [Sorghum bicolor] Length = 485 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYA+FLDD PE VKI++VSCGEYHTAAISENGEV Sbjct: 208 QGARVLNAYARFLDDAPEQVKIVRVSCGEYHTAAISENGEV 248 >ref|XP_010099306.1| hypothetical protein L484_018168 [Morus notabilis] gi|587888966|gb|EXB77652.1| hypothetical protein L484_018168 [Morus notabilis] Length = 471 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR +NAYAKFLD+ PELVK+ +VSCGEYHTAAISENGEV Sbjct: 207 QGARIINAYAKFLDEAPELVKVTRVSCGEYHTAAISENGEV 247 >ref|XP_010938025.1| PREDICTED: ultraviolet-B receptor UVR8 [Elaeis guineensis] Length = 473 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYA+FLD+ PEL+KI QVSCGEYHTAAISENGEV Sbjct: 207 QGARVLNAYARFLDEAPELLKITQVSCGEYHTAAISENGEV 247 >ref|XP_008794204.1| PREDICTED: ultraviolet-B receptor UVR8 [Phoenix dactylifera] gi|672140783|ref|XP_008794205.1| PREDICTED: ultraviolet-B receptor UVR8 [Phoenix dactylifera] Length = 475 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LNAYA+FLD+ PEL+KI QVSCGEYHTAAISENGEV Sbjct: 207 QGARVLNAYARFLDEAPELLKITQVSCGEYHTAAISENGEV 247 >ref|XP_006650287.1| PREDICTED: RCC1 and BTB domain-containing protein 1-like [Oryza brachyantha] Length = 479 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR LN YA+FLD+ PELVKII+VSCGEYHTAAISENGEV Sbjct: 207 QGARVLNVYARFLDEAPELVKIIRVSCGEYHTAAISENGEV 247 >ref|XP_011021075.1| PREDICTED: probable E3 ubiquitin-protein ligase HERC4 [Populus euphratica] Length = 477 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR +NAYAKFLD++PELVKI QVSCGEYHTAAISE GEV Sbjct: 207 QGARVINAYAKFLDESPELVKITQVSCGEYHTAAISEKGEV 247 >ref|XP_009378258.1| PREDICTED: ultraviolet-B receptor UVR8-like [Pyrus x bretschneideri] Length = 471 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR +NAYAKFLD+ PELVKI QVSCGEYHTAAISE GEV Sbjct: 209 QGARIINAYAKFLDEAPELVKITQVSCGEYHTAAISEKGEV 249 >ref|XP_008379452.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica] gi|657975221|ref|XP_008379453.1| PREDICTED: ultraviolet-B receptor UVR8-like [Malus domestica] Length = 471 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR +NAYAKFLD+ PELVKI QVSCGEYHTAAISE GEV Sbjct: 209 QGARIINAYAKFLDEAPELVKITQVSCGEYHTAAISEKGEV 249 >ref|XP_006373397.1| hypothetical protein POPTR_0017s13420g [Populus trichocarpa] gi|566213140|ref|XP_006373398.1| hypothetical protein POPTR_0017s13420g [Populus trichocarpa] gi|550320219|gb|ERP51194.1| hypothetical protein POPTR_0017s13420g [Populus trichocarpa] gi|550320220|gb|ERP51195.1| hypothetical protein POPTR_0017s13420g [Populus trichocarpa] Length = 477 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 393 QGARFLNAYAKFLDDTPELVKIIQVSCGEYHTAAISENGEV 271 QGAR +NAYAKFLD+ PELVKI QVSCGEYHTAAISE GEV Sbjct: 207 QGARVINAYAKFLDEAPELVKITQVSCGEYHTAAISEKGEV 247