BLASTX nr result
ID: Aconitum23_contig00042522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00042522 (370 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007163841.1| hypothetical protein PHAVU_001G268800g [Phas... 60 6e-07 >ref|XP_007163841.1| hypothetical protein PHAVU_001G268800g [Phaseolus vulgaris] gi|561037305|gb|ESW35835.1| hypothetical protein PHAVU_001G268800g [Phaseolus vulgaris] Length = 978 Score = 60.1 bits (144), Expect = 6e-07 Identities = 39/110 (35%), Positives = 61/110 (55%), Gaps = 1/110 (0%) Frame = -2 Query: 366 VQISENKRISQDDGKLQNSSESQCQVVSTMIEAEQNSKLSKGSSSENDLPL-LQASEAVS 190 VQ +E+K ++ + Q SSES V + + S + E+++PL +Q SE + Sbjct: 529 VQDTESKDECSNEFRGQPSSESNGPVCFPKDDQNLRPEFSSANGWEDEVPLQVQDSEVLL 588 Query: 189 VPCNEESSTGGEMAGKDSEVSSSLLGRRQDALDFVGFRDILIGSEMDSVP 40 +P EESS+ E+ G D E SSS+LG R + L+F GF D+ E+ + P Sbjct: 589 LPYKEESSSAAELIGGDGEASSSVLGGRPEELEFDGFGDLFNEPEVVAGP 638