BLASTX nr result
ID: Aconitum23_contig00042253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00042253 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013456636.1| ABC transporter B family protein [Medicago t... 46 6e-07 >ref|XP_013456636.1| ABC transporter B family protein [Medicago truncatula] gi|657388818|gb|KEH30667.1| ABC transporter B family protein [Medicago truncatula] Length = 1169 Score = 45.8 bits (107), Expect(2) = 6e-07 Identities = 20/50 (40%), Positives = 34/50 (68%) Frame = -2 Query: 160 FLLGPLHCFGFLIQVGKSIQMLSSFVGGFAVAFSHYWILVLIMMATVPFL 11 F + PL F QVG+ IQ +++F+GGF +AF+ W+L ++M+ ++P L Sbjct: 55 FFIVPLLSF----QVGQFIQFVATFIGGFVIAFTKGWLLTVVMLFSIPLL 100 Score = 34.3 bits (77), Expect(2) = 6e-07 Identities = 17/29 (58%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -3 Query: 357 ETNIREI-GRMSSDIVLIQDAIGEKVIVV 274 ETN E+ GRM+ D VLI+DA+GEK +V Sbjct: 30 ETNTGEVVGRMAGDTVLIKDAMGEKFFIV 58