BLASTX nr result
ID: Aconitum23_contig00040942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00040942 (393 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61953.1| hypothetical protein VITISV_015708 [Vitis vinifera] 67 4e-09 emb|CDP05229.1| unnamed protein product [Coffea canephora] 66 9e-09 ref|XP_006353398.1| PREDICTED: leucine-rich repeat receptor prot... 65 2e-08 dbj|BAF79943.1| receptor-like kinase [Marchantia polymorpha] 65 2e-08 ref|XP_012852097.1| PREDICTED: leucine-rich repeat receptor prot... 65 2e-08 ref|XP_011076203.1| PREDICTED: leucine-rich repeat receptor prot... 65 2e-08 gb|EYU25075.1| hypothetical protein MIMGU_mgv1a000313mg [Erythra... 65 2e-08 ref|XP_006827421.2| PREDICTED: leucine-rich repeat receptor prot... 65 3e-08 ref|XP_002273978.2| PREDICTED: leucine-rich repeat receptor prot... 65 3e-08 emb|CBI31817.3| unnamed protein product [Vitis vinifera] 65 3e-08 gb|ERM94837.1| hypothetical protein AMTR_s00009p00076890 [Ambore... 65 3e-08 ref|XP_009762812.1| PREDICTED: leucine-rich repeat receptor prot... 64 3e-08 ref|XP_009603013.1| PREDICTED: leucine-rich repeat receptor prot... 64 3e-08 ref|XP_011048672.1| PREDICTED: leucine-rich repeat receptor prot... 64 6e-08 ref|XP_012090287.1| PREDICTED: leucine-rich repeat receptor prot... 64 6e-08 ref|XP_002510817.1| leucine-rich repeat receptor protein kinase ... 64 6e-08 ref|XP_002322457.1| Leucine-rich repeat receptor protein kinase ... 64 6e-08 ref|XP_010107419.1| Leucine-rich repeat receptor protein kinase ... 63 8e-08 ref|XP_009371306.1| PREDICTED: leucine-rich repeat receptor prot... 63 8e-08 ref|XP_008377011.1| PREDICTED: leucine-rich repeat receptor prot... 63 8e-08 >emb|CAN61953.1| hypothetical protein VITISV_015708 [Vitis vinifera] Length = 1147 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/46 (73%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+WRSTTR DV SFGVILL+LVTGK G +FK+ E GNLVGWVF Sbjct: 1043 GQSWRSTTRGDVYSFGVILLELVTGKEPTGPDFKDFEGGNLVGWVF 1088 >emb|CDP05229.1| unnamed protein product [Coffea canephora] Length = 1280 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/46 (71%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+W+STTR DV SFGVILL+LVTGK G +FK+ E GNLVGWVF Sbjct: 1176 GQSWKSTTRGDVYSFGVILLELVTGKEPTGPDFKDIEGGNLVGWVF 1221 >ref|XP_006353398.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Solanum tuberosum] Length = 1272 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/45 (71%), Positives = 38/45 (84%), Gaps = 3/45 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWV 127 GQTW+STT+ DV SFGVILL+L+TGK GL+FK+ E GNLVGWV Sbjct: 1168 GQTWQSTTKGDVYSFGVILLELLTGKEPTGLDFKDVEGGNLVGWV 1212 >dbj|BAF79943.1| receptor-like kinase [Marchantia polymorpha] Length = 581 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/51 (62%), Positives = 41/51 (80%), Gaps = 3/51 (5%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVFSVLVQ 145 GQ+WRSTTR DV S+GVILL+L+TGK G++FK+ E GNLVGWV ++ Q Sbjct: 466 GQSWRSTTRGDVYSYGVILLELLTGKEPTGIDFKDIEGGNLVGWVRQMVKQ 516 >ref|XP_012852097.1| PREDICTED: leucine-rich repeat receptor protein kinase EMS1 [Erythranthe guttatus] Length = 1308 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+W+STTR DV SFGVILL+L+TGK G +FK+ E GNLVGWVF Sbjct: 1203 GQSWKSTTRGDVYSFGVILLELLTGKEPTGPDFKDIEGGNLVGWVF 1248 >ref|XP_011076203.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Sesamum indicum] Length = 1304 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+W+STTR DV SFGVILL+L+TGK G +FK+ E GNLVGWVF Sbjct: 1200 GQSWKSTTRGDVYSFGVILLELLTGKEPTGPDFKDIEGGNLVGWVF 1245 >gb|EYU25075.1| hypothetical protein MIMGU_mgv1a000313mg [Erythranthe guttata] Length = 1268 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+W+STTR DV SFGVILL+L+TGK G +FK+ E GNLVGWVF Sbjct: 1163 GQSWKSTTRGDVYSFGVILLELLTGKEPTGPDFKDIEGGNLVGWVF 1208 >ref|XP_006827421.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Amborella trichopoda] Length = 1252 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/51 (62%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVFSVLVQ 145 GQ+WRSTT+ DV SFGVILL++VTGK GL F + E GNLVGWV ++V+ Sbjct: 1148 GQSWRSTTKGDVYSFGVILLEMVTGKEPTGLGFDDFEGGNLVGWVREMVVR 1198 >ref|XP_002273978.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Vitis vinifera] Length = 1301 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/46 (71%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 G +WRSTTR DV SFGVILL+LVTGK G +FK+ E GNLVGWVF Sbjct: 1197 GLSWRSTTRGDVYSFGVILLELVTGKEPTGPDFKDFEGGNLVGWVF 1242 >emb|CBI31817.3| unnamed protein product [Vitis vinifera] Length = 961 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/46 (71%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 G +WRSTTR DV SFGVILL+LVTGK G +FK+ E GNLVGWVF Sbjct: 857 GLSWRSTTRGDVYSFGVILLELVTGKEPTGPDFKDFEGGNLVGWVF 902 >gb|ERM94837.1| hypothetical protein AMTR_s00009p00076890 [Amborella trichopoda] Length = 1330 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/51 (62%), Positives = 40/51 (78%), Gaps = 3/51 (5%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVFSVLVQ 145 GQ+WRSTT+ DV SFGVILL++VTGK GL F + E GNLVGWV ++V+ Sbjct: 1226 GQSWRSTTKGDVYSFGVILLEMVTGKEPTGLGFDDFEGGNLVGWVREMVVR 1276 >ref|XP_009762812.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Nicotiana sylvestris] Length = 1227 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 3/45 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWV 127 GQTWRSTT+ DV SFGVILL+L+TGK G +FK+ E GNLVGWV Sbjct: 1123 GQTWRSTTKGDVYSFGVILLELLTGKEPTGPDFKDVEGGNLVGWV 1167 >ref|XP_009603013.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Nicotiana tomentosiformis] Length = 1227 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 3/45 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWV 127 GQTWRSTT+ DV SFGVILL+L+TGK G +FK+ E GNLVGWV Sbjct: 1123 GQTWRSTTKGDVYSFGVILLELLTGKEPTGPDFKDVEGGNLVGWV 1167 >ref|XP_011048672.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Populus euphratica] Length = 1295 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+ RSTTR DV SFGVILL+LVTGK G +FKE E GNLVGWVF Sbjct: 1191 GQSGRSTTRGDVYSFGVILLELVTGKEPTGPDFKEVEGGNLVGWVF 1236 >ref|XP_012090287.1| PREDICTED: leucine-rich repeat receptor protein kinase EMS1 [Jatropha curcas] gi|643706175|gb|KDP22307.1| hypothetical protein JCGZ_26138 [Jatropha curcas] Length = 1272 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+ RSTTR DV SFGVILL+LVTGK G +FKE E GNLVGWVF Sbjct: 1168 GQSGRSTTRGDVYSFGVILLELVTGKEPTGPDFKEVEGGNLVGWVF 1213 >ref|XP_002510817.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] gi|223549932|gb|EEF51419.1| leucine-rich repeat receptor protein kinase exs precursor, putative [Ricinus communis] Length = 1303 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+ RSTTR DV SFGVILL+LVTGK G +FKE E GNLVGWVF Sbjct: 1197 GQSGRSTTRGDVYSFGVILLELVTGKEPTGPDFKEVEGGNLVGWVF 1242 >ref|XP_002322457.1| Leucine-rich repeat receptor protein kinase EXS precursor [Populus trichocarpa] gi|222869453|gb|EEF06584.1| Leucine-rich repeat receptor protein kinase EXS precursor [Populus trichocarpa] Length = 1215 Score = 63.5 bits (153), Expect = 6e-08 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+ RSTTR DV SFGVILL+LVTGK G +FKE E GNLVGWVF Sbjct: 1111 GQSGRSTTRGDVYSFGVILLELVTGKEPTGPDFKEVEGGNLVGWVF 1156 >ref|XP_010107419.1| Leucine-rich repeat receptor protein kinase EXS [Morus notabilis] gi|587928771|gb|EXC15957.1| Leucine-rich repeat receptor protein kinase EXS [Morus notabilis] Length = 1274 Score = 63.2 bits (152), Expect = 8e-08 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVF 130 GQ+ RSTTR DV SFGVILL+LVTGK G +FKE E GNLVGWVF Sbjct: 1170 GQSARSTTRGDVYSFGVILLELVTGKEPTGPDFKEIEGGNLVGWVF 1215 >ref|XP_009371306.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS [Pyrus x bretschneideri] Length = 1297 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/49 (67%), Positives = 39/49 (79%), Gaps = 3/49 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVFSVL 139 GQ+ RSTT+ DV SFGVILL+LVTG G +FK+SE GNLVGWVF +L Sbjct: 1193 GQSARSTTKGDVYSFGVILLELVTGNEPTGPDFKDSEGGNLVGWVFQML 1241 >ref|XP_008377011.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Malus domestica] Length = 1297 Score = 63.2 bits (152), Expect = 8e-08 Identities = 33/49 (67%), Positives = 39/49 (79%), Gaps = 3/49 (6%) Frame = +2 Query: 2 GQTWRSTTRWDVCSFGVILLKLVTGK---GLNFKESESGNLVGWVFSVL 139 GQ+ RSTT+ DV SFGVILL+LVTGK G +FK+ E GNLVGWVF +L Sbjct: 1193 GQSGRSTTKGDVYSFGVILLELVTGKEPTGPDFKDLEGGNLVGWVFQML 1241