BLASTX nr result
ID: Aconitum23_contig00040926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00040926 (368 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011046631.1| PREDICTED: pentatricopeptide repeat-containi... 54 1e-05 >ref|XP_011046631.1| PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Populus euphratica] Length = 800 Score = 53.9 bits (128), Expect(2) = 1e-05 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -3 Query: 366 IDMYSKFGFVLWSQKVFDEMPERNLVSWNMMVSG 265 IDMY K GF+ ++KVFDEMP R+LVSWN MVSG Sbjct: 166 IDMYLKIGFIKLAEKVFDEMPVRDLVSWNSMVSG 199 Score = 21.9 bits (45), Expect(2) = 1e-05 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 191 CSQLGVLTHCQVVQSCATYIP*ELELYVL 105 C + G+ HCQV++S ELEL ++ Sbjct: 240 CLRSGMEIHCQVIRS-------ELELDIM 261