BLASTX nr result
ID: Aconitum23_contig00040757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00040757 (441 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010028122.1| PREDICTED: uncharacterized protein LOC104418... 63 8e-08 ref|XP_010028121.1| PREDICTED: uncharacterized protein LOC104418... 63 8e-08 gb|KCW54778.1| hypothetical protein EUGRSUZ_I00723 [Eucalyptus g... 63 8e-08 ref|XP_010679583.1| PREDICTED: uncharacterized protein LOC104894... 62 2e-07 gb|KNA10189.1| hypothetical protein SOVF_146710 isoform B [Spina... 61 4e-07 gb|KNA10188.1| hypothetical protein SOVF_146710 isoform A [Spina... 61 4e-07 ref|XP_010277119.1| PREDICTED: uncharacterized protein LOC104611... 61 4e-07 ref|XP_010277118.1| PREDICTED: uncharacterized protein LOC104611... 61 4e-07 ref|XP_010277116.1| PREDICTED: uncharacterized protein LOC104611... 61 4e-07 ref|XP_010277115.1| PREDICTED: uncharacterized protein LOC104611... 61 4e-07 emb|CDP02571.1| unnamed protein product [Coffea canephora] 61 4e-07 ref|XP_010444926.1| PREDICTED: uncharacterized protein LOC104727... 60 6e-07 gb|KQK86981.1| hypothetical protein SETIT_035370mg [Setaria ital... 60 8e-07 ref|XP_006841994.2| PREDICTED: uncharacterized protein LOC184318... 60 8e-07 ref|XP_011099334.1| PREDICTED: uncharacterized protein LOC105177... 60 8e-07 ref|XP_006364422.1| PREDICTED: uncharacterized protein LOC102591... 60 8e-07 ref|XP_006364421.1| PREDICTED: uncharacterized protein LOC102591... 60 8e-07 gb|ERN03669.1| hypothetical protein AMTR_s00144p00074180 [Ambore... 60 8e-07 ref|XP_004981674.1| PREDICTED: uncharacterized protein LOC101760... 60 8e-07 gb|KMZ72908.1| hypothetical protein ZOSMA_158G00180 [Zostera mar... 59 1e-06 >ref|XP_010028122.1| PREDICTED: uncharacterized protein LOC104418461 isoform X2 [Eucalyptus grandis] Length = 547 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRN-KSKTV 1 +FWLFEPRCAMHDIGGWYVET+GR+ KSKTV Sbjct: 476 KFWLFEPRCAMHDIGGWYVETFGRDEKSKTV 506 >ref|XP_010028121.1| PREDICTED: uncharacterized protein LOC104418461 isoform X1 [Eucalyptus grandis] Length = 570 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRN-KSKTV 1 +FWLFEPRCAMHDIGGWYVET+GR+ KSKTV Sbjct: 476 KFWLFEPRCAMHDIGGWYVETFGRDEKSKTV 506 >gb|KCW54778.1| hypothetical protein EUGRSUZ_I00723 [Eucalyptus grandis] Length = 525 Score = 63.2 bits (152), Expect = 8e-08 Identities = 27/31 (87%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRN-KSKTV 1 +FWLFEPRCAMHDIGGWYVET+GR+ KSKTV Sbjct: 431 KFWLFEPRCAMHDIGGWYVETFGRDEKSKTV 461 >ref|XP_010679583.1| PREDICTED: uncharacterized protein LOC104894918 [Beta vulgaris subsp. vulgaris] gi|870858278|gb|KMT09796.1| hypothetical protein BVRB_6g127760 [Beta vulgaris subsp. vulgaris] Length = 534 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%), Gaps = 1/31 (3%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRN-KSKTV 1 +FWLFEPRC+MHDIGGWYVETYGR+ KS+TV Sbjct: 440 KFWLFEPRCSMHDIGGWYVETYGRDRKSQTV 470 >gb|KNA10189.1| hypothetical protein SOVF_146710 isoform B [Spinacia oleracea] Length = 558 Score = 60.8 bits (146), Expect = 4e-07 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNKSK 7 +FWLFEPRC+MHDIGGWYVETYGR++ + Sbjct: 464 KFWLFEPRCSMHDIGGWYVETYGRDRQR 491 >gb|KNA10188.1| hypothetical protein SOVF_146710 isoform A [Spinacia oleracea] Length = 537 Score = 60.8 bits (146), Expect = 4e-07 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNKSK 7 +FWLFEPRC+MHDIGGWYVETYGR++ + Sbjct: 443 KFWLFEPRCSMHDIGGWYVETYGRDRQR 470 >ref|XP_010277119.1| PREDICTED: uncharacterized protein LOC104611653 isoform X4 [Nelumbo nucifera] Length = 521 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNK 13 RFWLFEPRC+MHDIGGWYVET+GR+K Sbjct: 440 RFWLFEPRCSMHDIGGWYVETFGRDK 465 >ref|XP_010277118.1| PREDICTED: uncharacterized protein LOC104611653 isoform X3 [Nelumbo nucifera] Length = 535 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNK 13 RFWLFEPRC+MHDIGGWYVET+GR+K Sbjct: 440 RFWLFEPRCSMHDIGGWYVETFGRDK 465 >ref|XP_010277116.1| PREDICTED: uncharacterized protein LOC104611653 isoform X2 [Nelumbo nucifera] Length = 539 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNK 13 RFWLFEPRC+MHDIGGWYVET+GR+K Sbjct: 440 RFWLFEPRCSMHDIGGWYVETFGRDK 465 >ref|XP_010277115.1| PREDICTED: uncharacterized protein LOC104611653 isoform X1 [Nelumbo nucifera] Length = 541 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNK 13 RFWLFEPRC+MHDIGGWYVET+GR+K Sbjct: 440 RFWLFEPRCSMHDIGGWYVETFGRDK 465 >emb|CDP02571.1| unnamed protein product [Coffea canephora] Length = 525 Score = 60.8 bits (146), Expect = 4e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNK 13 +FWLFEPRC MHDIGGWYVETYGR+K Sbjct: 431 KFWLFEPRCGMHDIGGWYVETYGRDK 456 >ref|XP_010444926.1| PREDICTED: uncharacterized protein LOC104727528 [Camelina sativa] Length = 534 Score = 60.1 bits (144), Expect = 6e-07 Identities = 23/31 (74%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRN-KSKTV 1 RFWLFEPRC +HD+GGWY+ETYG++ KS+TV Sbjct: 433 RFWLFEPRCGLHDVGGWYIETYGKDKKSRTV 463 >gb|KQK86981.1| hypothetical protein SETIT_035370mg [Setaria italica] Length = 493 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNK 13 R+WLFEPRC MHDIGGWY+ETYGR+K Sbjct: 390 RYWLFEPRCYMHDIGGWYIETYGRDK 415 >ref|XP_006841994.2| PREDICTED: uncharacterized protein LOC18431816 [Amborella trichopoda] Length = 528 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRN-KSKTV 1 +FWLFEPRC MHDIGGWY+ET+GR+ K KTV Sbjct: 431 KFWLFEPRCGMHDIGGWYIETFGRDKKGKTV 461 >ref|XP_011099334.1| PREDICTED: uncharacterized protein LOC105177782 [Sesamum indicum] Length = 539 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/31 (83%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGR-NKSKTV 1 +FWLFEPR AMHDIGGWYVET+GR NK KTV Sbjct: 445 KFWLFEPRSAMHDIGGWYVETFGRDNKGKTV 475 >ref|XP_006364422.1| PREDICTED: uncharacterized protein LOC102591429 isoform X2 [Solanum tuberosum] Length = 505 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNKS 10 +FWLFEPRC MHDIGGWYVET+GR+K+ Sbjct: 436 KFWLFEPRCGMHDIGGWYVETFGRDKT 462 >ref|XP_006364421.1| PREDICTED: uncharacterized protein LOC102591429 isoform X1 [Solanum tuberosum] Length = 531 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNKS 10 +FWLFEPRC MHDIGGWYVET+GR+K+ Sbjct: 436 KFWLFEPRCGMHDIGGWYVETFGRDKT 462 >gb|ERN03669.1| hypothetical protein AMTR_s00144p00074180 [Amborella trichopoda] Length = 521 Score = 59.7 bits (143), Expect = 8e-07 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRN-KSKTV 1 +FWLFEPRC MHDIGGWY+ET+GR+ K KTV Sbjct: 424 KFWLFEPRCGMHDIGGWYIETFGRDKKGKTV 454 >ref|XP_004981674.1| PREDICTED: uncharacterized protein LOC101760266 [Setaria italica] gi|836017738|ref|XP_012704138.1| PREDICTED: uncharacterized protein LOC101760266 [Setaria italica] Length = 511 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNK 13 R+WLFEPRC MHDIGGWY+ETYGR+K Sbjct: 408 RYWLFEPRCYMHDIGGWYIETYGRDK 433 >gb|KMZ72908.1| hypothetical protein ZOSMA_158G00180 [Zostera marina] Length = 472 Score = 59.3 bits (142), Expect = 1e-06 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = -1 Query: 90 RFWLFEPRCAMHDIGGWYVETYGRNK 13 +FWLFEPRC +HD+GGWY+ET+GRNK Sbjct: 380 KFWLFEPRCGLHDVGGWYIETFGRNK 405