BLASTX nr result
ID: Aconitum23_contig00040518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00040518 (462 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010093742.1| hypothetical protein L484_019144 [Morus nota... 94 3e-17 ref|XP_008243533.1| PREDICTED: putative pentatricopeptide repeat... 93 7e-17 ref|XP_010276178.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 ref|XP_009377863.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 ref|XP_009366723.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 ref|XP_008391851.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 gb|KDO70458.1| hypothetical protein CISIN_1g043362mg, partial [C... 92 2e-16 ref|XP_006481751.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 ref|XP_006430175.1| hypothetical protein CICLE_v10011274mg [Citr... 92 2e-16 ref|XP_011004222.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 gb|KFK38519.1| hypothetical protein AALP_AA3G124100 [Arabis alpina] 91 3e-16 emb|CDP15436.1| unnamed protein product [Coffea canephora] 91 3e-16 ref|XP_010486809.1| PREDICTED: putative pentatricopeptide repeat... 91 4e-16 ref|XP_010464856.1| PREDICTED: putative pentatricopeptide repeat... 91 4e-16 ref|XP_012072980.1| PREDICTED: putative pentatricopeptide repeat... 90 6e-16 ref|XP_012459152.1| PREDICTED: pentatricopeptide repeat-containi... 90 6e-16 gb|KDP37311.1| hypothetical protein JCGZ_06765 [Jatropha curcas] 90 6e-16 ref|XP_002882733.1| pentatricopeptide repeat-containing protein ... 90 6e-16 gb|KHN46017.1| Putative pentatricopeptide repeat-containing prot... 90 8e-16 emb|CBI30310.3| unnamed protein product [Vitis vinifera] 90 8e-16 >ref|XP_010093742.1| hypothetical protein L484_019144 [Morus notabilis] gi|587864991|gb|EXB54575.1| hypothetical protein L484_019144 [Morus notabilis] Length = 636 Score = 94.4 bits (233), Expect = 3e-17 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLR CGDCHLFIKLVSKIVDR+F+VRD +RFHHFKDGVCSC +YW Sbjct: 591 KNLRACGDCHLFIKLVSKIVDRKFVVRDATRFHHFKDGVCSCRDYW 636 >ref|XP_008243533.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Prunus mume] Length = 606 Score = 93.2 bits (230), Expect = 7e-17 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVCGDCHLFIKLVSKIVDR+F+VRD +RFHHF++GVCSC +YW Sbjct: 561 KNLRVCGDCHLFIKLVSKIVDRQFVVRDATRFHHFRNGVCSCKDYW 606 >ref|XP_010276178.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Nelumbo nucifera] Length = 613 Score = 92.0 bits (227), Expect = 2e-16 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVCGDCH+FIK+VSKIVDR+ +VRD SRFHHF++GVCSCN+YW Sbjct: 568 KNLRVCGDCHVFIKMVSKIVDRKIVVRDASRFHHFRNGVCSCNDYW 613 >ref|XP_009377863.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Pyrus x bretschneideri] gi|694406126|ref|XP_009377889.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Pyrus x bretschneideri] Length = 606 Score = 92.0 bits (227), Expect = 2e-16 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVCGDCHLFIKLVS+IVDR+F+VRD +RFHHF++GVCSC +YW Sbjct: 561 KNLRVCGDCHLFIKLVSRIVDRQFVVRDATRFHHFRNGVCSCKDYW 606 >ref|XP_009366723.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Pyrus x bretschneideri] Length = 606 Score = 92.0 bits (227), Expect = 2e-16 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVCGDCHLFIKLVS+IVDR+F+VRD +RFHHF++GVCSC +YW Sbjct: 561 KNLRVCGDCHLFIKLVSRIVDRQFVVRDATRFHHFRNGVCSCKDYW 606 >ref|XP_008391851.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Malus domestica] Length = 606 Score = 92.0 bits (227), Expect = 2e-16 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVCGDCHLFIKLVS+IVDR+F+VRD +RFHHF++GVCSC +YW Sbjct: 561 KNLRVCGDCHLFIKLVSRIVDRQFVVRDATRFHHFRNGVCSCKDYW 606 >gb|KDO70458.1| hypothetical protein CISIN_1g043362mg, partial [Citrus sinensis] Length = 516 Score = 92.0 bits (227), Expect = 2e-16 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLR+CGDCHLFIKLVSKIVDR+FIVRD +RFHHFK G CSC +YW Sbjct: 471 KNLRICGDCHLFIKLVSKIVDRQFIVRDATRFHHFKSGFCSCKDYW 516 >ref|XP_006481751.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Citrus sinensis] Length = 636 Score = 92.0 bits (227), Expect = 2e-16 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLR+CGDCHLFIKLVSKIVDR+FIVRD +RFHHFK G CSC +YW Sbjct: 591 KNLRICGDCHLFIKLVSKIVDRQFIVRDATRFHHFKSGFCSCKDYW 636 >ref|XP_006430175.1| hypothetical protein CICLE_v10011274mg [Citrus clementina] gi|557532232|gb|ESR43415.1| hypothetical protein CICLE_v10011274mg [Citrus clementina] Length = 636 Score = 92.0 bits (227), Expect = 2e-16 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLR+CGDCHLFIKLVSKIVDR+FIVRD +RFHHFK G CSC +YW Sbjct: 591 KNLRICGDCHLFIKLVSKIVDRQFIVRDATRFHHFKSGFCSCKDYW 636 >ref|XP_011004222.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Populus euphratica] Length = 625 Score = 91.7 bits (226), Expect = 2e-16 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLR+CGDCHLFIKLVSKIVDR+F+VRD +RFHHFK+G CSC YW Sbjct: 580 KNLRICGDCHLFIKLVSKIVDRQFVVRDATRFHHFKNGFCSCKEYW 625 >gb|KFK38519.1| hypothetical protein AALP_AA3G124100 [Arabis alpina] Length = 620 Score = 91.3 bits (225), Expect = 3e-16 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVC DCH+FIK+VSKIVDR F++RD SRFH+FKDGVCSCN+YW Sbjct: 575 KNLRVCKDCHVFIKMVSKIVDRRFVIRDASRFHYFKDGVCSCNDYW 620 >emb|CDP15436.1| unnamed protein product [Coffea canephora] Length = 641 Score = 91.3 bits (225), Expect = 3e-16 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLR+CGDCHLFIK+VSKIVDR+F+VRD +RFHHF+ G CSCN+YW Sbjct: 596 KNLRMCGDCHLFIKMVSKIVDRQFVVRDATRFHHFRGGACSCNDYW 641 >ref|XP_010486809.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Camelina sativa] Length = 623 Score = 90.5 bits (223), Expect = 4e-16 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVC DCH+FIKLVSKIVDR+F+VRD SRFH+FKDG+CSC +YW Sbjct: 578 KNLRVCEDCHVFIKLVSKIVDRQFVVRDASRFHYFKDGICSCKDYW 623 >ref|XP_010464856.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Camelina sativa] Length = 623 Score = 90.5 bits (223), Expect = 4e-16 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVC DCH+FIKLVSKIVDR+F+VRD SRFH+FKDG+CSC +YW Sbjct: 578 KNLRVCEDCHVFIKLVSKIVDRQFVVRDASRFHYFKDGICSCKDYW 623 >ref|XP_012072980.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460 [Jatropha curcas] Length = 614 Score = 90.1 bits (222), Expect = 6e-16 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLR+CGDCHLFIKLVSKIVD +FIVRD +RFHHF++G+CSC +YW Sbjct: 569 KNLRICGDCHLFIKLVSKIVDHQFIVRDATRFHHFRNGLCSCKDYW 614 >ref|XP_012459152.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Gossypium raimondii] gi|763809412|gb|KJB76314.1| hypothetical protein B456_012G082800 [Gossypium raimondii] Length = 659 Score = 90.1 bits (222), Expect = 6e-16 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLR+CGDCH FIKL+SKIVDRE +VRD RFHHFKDG CSC +YW Sbjct: 614 KNLRICGDCHTFIKLISKIVDREIVVRDSKRFHHFKDGFCSCGDYW 659 >gb|KDP37311.1| hypothetical protein JCGZ_06765 [Jatropha curcas] Length = 628 Score = 90.1 bits (222), Expect = 6e-16 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLR+CGDCHLFIKLVSKIVD +FIVRD +RFHHF++G+CSC +YW Sbjct: 583 KNLRICGDCHLFIKLVSKIVDHQFIVRDATRFHHFRNGLCSCKDYW 628 >ref|XP_002882733.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328573|gb|EFH58992.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 620 Score = 90.1 bits (222), Expect = 6e-16 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVC DCH+FIKLVSKIVDR F+VRD SRFH+FKDGVCSC +YW Sbjct: 575 KNLRVCEDCHVFIKLVSKIVDRRFVVRDASRFHYFKDGVCSCKDYW 620 >gb|KHN46017.1| Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 409 Score = 89.7 bits (221), Expect = 8e-16 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVC DCHLFIKLVSKIV+R+FIVRD +RFHHF+DG+CSC +YW Sbjct: 364 KNLRVCVDCHLFIKLVSKIVNRQFIVRDATRFHHFRDGICSCKDYW 409 >emb|CBI30310.3| unnamed protein product [Vitis vinifera] Length = 543 Score = 89.7 bits (221), Expect = 8e-16 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 462 KNLRVCGDCHLFIKLVSKIVDREFIVRDPSRFHHFKDGVCSCNNYW 325 KNLRVCGDCHLF+KLVS+IVDR+ +VRD +RFHHFK+GVCSC +YW Sbjct: 498 KNLRVCGDCHLFLKLVSEIVDRQLVVRDATRFHHFKNGVCSCKDYW 543