BLASTX nr result
ID: Aconitum23_contig00039782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00039782 (368 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO59349.1| hypothetical protein CISIN_1g036975mg [Citrus sin... 58 2e-06 ref|XP_006453699.1| hypothetical protein CICLE_v10010646mg [Citr... 58 2e-06 >gb|KDO59349.1| hypothetical protein CISIN_1g036975mg [Citrus sinensis] Length = 91 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = -1 Query: 206 LQFVYNGCLSMFDSSKERRPYHKNCGYALHKLKKN--GIEFCSQRRKVSILAKQSRQKFA 33 LQ V+NG LS+ D KERRPYH++C ALHKLK +CSQ+R VS + +Q ++ Sbjct: 11 LQCVFNGNLSLHDMHKERRPYHRDCDCALHKLKGTVCSDAYCSQKRNVSFPNNKKKQSWS 70 >ref|XP_006453699.1| hypothetical protein CICLE_v10010646mg [Citrus clementina] gi|557556925|gb|ESR66939.1| hypothetical protein CICLE_v10010646mg [Citrus clementina] Length = 113 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = -1 Query: 206 LQFVYNGCLSMFDSSKERRPYHKNCGYALHKLKKN--GIEFCSQRRKVSILAKQSRQKFA 33 LQ V+NG LS+ D KERRPYH++C ALHKLK +CSQ+R VS + +Q ++ Sbjct: 11 LQCVFNGNLSLHDMHKERRPYHRDCDCALHKLKGTVCSDAYCSQKRNVSFPNNKKKQSWS 70