BLASTX nr result
ID: Aconitum23_contig00039723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00039723 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852901.1| PREDICTED: uncharacterized protein LOC105972... 47 8e-06 >ref|XP_012852901.1| PREDICTED: uncharacterized protein LOC105972485 [Erythranthe guttatus] Length = 293 Score = 47.4 bits (111), Expect(2) = 8e-06 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = -1 Query: 277 YDRLPHFCFRCGLIGHLEGLCPLPRSAQ----QHSRPYGMWLRA 158 Y++LP FCF CG++GH E CPL Q PYG+W++A Sbjct: 165 YEKLPTFCFLCGIVGHTEPKCPLRYDDQFADPGDDFPYGVWMKA 208 Score = 28.9 bits (63), Expect(2) = 8e-06 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -3 Query: 425 IGSFIGLDDTYQAP-EGFLAIRVTIDISKPLLRGF 324 +GSF +++QA FL I+V +D++K L RGF Sbjct: 115 LGSFTQFLNSHQADVASFLRIKVAVDVTKCLQRGF 149