BLASTX nr result
ID: Aconitum23_contig00039616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00039616 (367 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085662.1| PREDICTED: elongation of fatty acids protein... 79 2e-12 ref|XP_012852600.1| PREDICTED: elongation of fatty acids protein... 78 2e-12 ref|XP_010254966.1| PREDICTED: elongation of fatty acids protein... 78 2e-12 gb|EYU44307.1| hypothetical protein MIMGU_mgv1a010872mg [Erythra... 78 2e-12 ref|XP_002533270.1| conserved hypothetical protein [Ricinus comm... 76 1e-11 ref|XP_004141955.1| PREDICTED: elongation of fatty acids protein... 75 2e-11 ref|XP_002310199.1| hypothetical protein POPTR_0007s12290g [Popu... 75 3e-11 ref|XP_011099280.1| PREDICTED: elongation of fatty acids protein... 74 4e-11 ref|XP_010070453.1| PREDICTED: elongation of fatty acids protein... 74 6e-11 gb|KCW59245.1| hypothetical protein EUGRSUZ_H01922 [Eucalyptus g... 74 6e-11 ref|XP_011025707.1| PREDICTED: elongation of fatty acids protein... 73 1e-10 ref|XP_009799692.1| PREDICTED: elongation of fatty acids protein... 73 1e-10 ref|XP_009606347.1| PREDICTED: elongation of fatty acids protein... 73 1e-10 ref|XP_008440157.1| PREDICTED: uncharacterized protein LOC103484... 73 1e-10 ref|XP_009597776.1| PREDICTED: elongation of fatty acids protein... 72 1e-10 ref|XP_012452866.1| PREDICTED: elongation of fatty acids protein... 72 2e-10 gb|KHN42016.1| hypothetical protein glysoja_003756 [Glycine soja] 71 3e-10 ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein... 71 3e-10 ref|XP_009374218.1| PREDICTED: elongation of fatty acids protein... 70 6e-10 ref|XP_008361373.1| PREDICTED: uncharacterized protein LOC103425... 70 6e-10 >ref|XP_011085662.1| PREDICTED: elongation of fatty acids protein 3-like [Sesamum indicum] Length = 302 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/68 (57%), Positives = 49/68 (72%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSRTSSPSLTMQSDSLGLNVNG 185 LHF+KGGC GIGAWVFNSV+NGAIL L LNFYV+MHL K R + S T + V Sbjct: 234 LHFIKGGCNGIGAWVFNSVLNGAILFLFLNFYVRMHL-KKRKAGASATAAAGDDRRYVAE 292 Query: 186 EIQMIKEK 209 ++++IK+K Sbjct: 293 KLELIKDK 300 >ref|XP_012852600.1| PREDICTED: elongation of fatty acids protein 3-like [Erythranthe guttatus] Length = 296 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNK 122 LHF+KGGC GIGAWVFNSV+NGAILLL+LNFYVKMHL K Sbjct: 234 LHFVKGGCNGIGAWVFNSVLNGAILLLVLNFYVKMHLRK 272 >ref|XP_010254966.1| PREDICTED: elongation of fatty acids protein 3-like [Nelumbo nucifera] Length = 300 Score = 78.2 bits (191), Expect = 2e-12 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 3/71 (4%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSRT---SSPSLTMQSDSLGLN 176 LHFMKGGC GIGAWVFNSV+NGAILL LNFYV++HL K +T + T S S L Sbjct: 229 LHFMKGGCNGIGAWVFNSVLNGAILLFFLNFYVRVHLRKRKTVAVRDENSTFHSCS-ALE 287 Query: 177 VNGEIQMIKEK 209 +++ IK+K Sbjct: 288 TRKDMEQIKDK 298 >gb|EYU44307.1| hypothetical protein MIMGU_mgv1a010872mg [Erythranthe guttata] Length = 299 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNK 122 LHF+KGGC GIGAWVFNSV+NGAILLL+LNFYVKMHL K Sbjct: 234 LHFVKGGCNGIGAWVFNSVLNGAILLLVLNFYVKMHLRK 272 >ref|XP_002533270.1| conserved hypothetical protein [Ricinus communis] gi|223526895|gb|EEF29102.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSR 128 LH MKGGC GIGAW+FNSV+NGAILLL LNFYVKMHL K + Sbjct: 238 LHLMKGGCNGIGAWIFNSVLNGAILLLFLNFYVKMHLAKKK 278 >ref|XP_004141955.1| PREDICTED: elongation of fatty acids protein 3-like [Cucumis sativus] gi|700193242|gb|KGN48446.1| hypothetical protein Csa_6G487670 [Cucumis sativus] Length = 316 Score = 75.1 bits (183), Expect = 2e-11 Identities = 42/79 (53%), Positives = 51/79 (64%), Gaps = 11/79 (13%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSRTSSP-----------SLTM 152 LHFMKGGC GIGAW FNSV+NGAILLL LNFY+K+HL + S S + Sbjct: 237 LHFMKGGCNGIGAWSFNSVLNGAILLLFLNFYLKIHLGDTEDSVKIIKHHHHQPPCSGNL 296 Query: 153 QSDSLGLNVNGEIQMIKEK 209 ++ SLG ++ E Q IKEK Sbjct: 297 KNQSLGKRMS-ESQNIKEK 314 >ref|XP_002310199.1| hypothetical protein POPTR_0007s12290g [Populus trichocarpa] gi|222853102|gb|EEE90649.1| hypothetical protein POPTR_0007s12290g [Populus trichocarpa] Length = 279 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +3 Query: 3 SLHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSRTSS 137 SLHFMKGGC GIGAW FNSV+NGAIL L LNFYVKM+L K + S Sbjct: 231 SLHFMKGGCNGIGAWWFNSVLNGAILFLFLNFYVKMYLGKRKEHS 275 >ref|XP_011099280.1| PREDICTED: elongation of fatty acids protein 3-like [Sesamum indicum] Length = 300 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSR 128 LHF+KGGC GIGAW+FNSV+NGAIL L LNFYVK HL K++ Sbjct: 234 LHFIKGGCNGIGAWIFNSVLNGAILFLFLNFYVKKHLRKTK 274 >ref|XP_010070453.1| PREDICTED: elongation of fatty acids protein 3-like [Eucalyptus grandis] Length = 336 Score = 73.6 bits (179), Expect = 6e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 3 SLHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSR 128 +LH +KGGC GIGAWVFNSV+NGA+L+L L FYVKMHL K R Sbjct: 238 TLHLVKGGCNGIGAWVFNSVLNGAVLMLFLKFYVKMHLGKKR 279 >gb|KCW59245.1| hypothetical protein EUGRSUZ_H01922 [Eucalyptus grandis] Length = 296 Score = 73.6 bits (179), Expect = 6e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +3 Query: 3 SLHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSR 128 +LH +KGGC GIGAWVFNSV+NGA+L+L L FYVKMHL K R Sbjct: 238 TLHLVKGGCNGIGAWVFNSVLNGAVLMLFLKFYVKMHLGKKR 279 >ref|XP_011025707.1| PREDICTED: elongation of fatty acids protein 3-like [Populus euphratica] Length = 289 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +3 Query: 3 SLHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSR 128 SLHF+KGGC GIGAW FNSV+NGAIL L LNFYVKM+L K + Sbjct: 231 SLHFLKGGCNGIGAWWFNSVLNGAILFLFLNFYVKMYLGKRK 272 >ref|XP_009799692.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana sylvestris] Length = 290 Score = 72.8 bits (177), Expect = 1e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSR 128 LHF+KGGC GIGAWV NSV+NGAIL L LNFYVK+HL K + Sbjct: 232 LHFLKGGCNGIGAWVLNSVLNGAILFLFLNFYVKLHLEKRK 272 >ref|XP_009606347.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana tomentosiformis] Length = 290 Score = 72.8 bits (177), Expect = 1e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSR 128 LHF+KGGC GIGAWV NSV+NGAIL L LNFYVK+HL K + Sbjct: 232 LHFLKGGCNGIGAWVLNSVLNGAILFLFLNFYVKLHLEKRK 272 >ref|XP_008440157.1| PREDICTED: uncharacterized protein LOC103484706 [Cucumis melo] Length = 316 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSRTS 134 LHFMKGGC GIGAW FNSV+NGAILLL LNFY+K+HL + S Sbjct: 237 LHFMKGGCNGIGAWSFNSVLNGAILLLFLNFYLKIHLGDTEDS 279 >ref|XP_009597776.1| PREDICTED: elongation of fatty acids protein 3-like [Nicotiana tomentosiformis] Length = 288 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/46 (71%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +3 Query: 6 LHFMK-GGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSRTSSP 140 LHFMK GGC GIGAWVFNSV+N AIL L+LNFYVKMHL + +P Sbjct: 232 LHFMKRGGCNGIGAWVFNSVLNAAILFLLLNFYVKMHLGNRKVKTP 277 >ref|XP_012452866.1| PREDICTED: elongation of fatty acids protein 3-like [Gossypium raimondii] gi|763796767|gb|KJB63722.1| hypothetical protein B456_010G012400 [Gossypium raimondii] Length = 307 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/62 (58%), Positives = 42/62 (67%), Gaps = 9/62 (14%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNK---------SRTSSPSLTMQS 158 LHF+KGGC G+GAW FNSV+NG IL+L LNFYVKMHL K S +SS S + S Sbjct: 234 LHFLKGGCNGMGAWGFNSVLNGVILILFLNFYVKMHLRKKNVEDIDGNSNSSSSSSSSSS 293 Query: 159 DS 164 S Sbjct: 294 SS 295 >gb|KHN42016.1| hypothetical protein glysoja_003756 [Glycine soja] Length = 280 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSR 128 LHF+ GGC GIGAWVFNSV+NGAILLL LNFYV+M+L + R Sbjct: 203 LHFLTGGCNGIGAWVFNSVLNGAILLLFLNFYVRMYLARRR 243 >ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein A-like [Glycine max] gi|947079811|gb|KRH28600.1| hypothetical protein GLYMA_11G063600 [Glycine max] Length = 323 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSR 128 LHF+ GGC GIGAWVFNSV+NGAILLL LNFYV+M+L + R Sbjct: 246 LHFLTGGCNGIGAWVFNSVLNGAILLLFLNFYVRMYLARRR 286 >ref|XP_009374218.1| PREDICTED: elongation of fatty acids protein sre1-like [Pyrus x bretschneideri] Length = 302 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/68 (48%), Positives = 43/68 (63%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSRTSSPSLTMQSDSLGLNVNG 185 +HFMKGGC GIGAWVFNSV+NG ILL LNFYV++HL + S + G + Sbjct: 233 VHFMKGGCNGIGAWVFNSVLNGVILLAFLNFYVRIHLGFFNKKGKGRGVSSGAGGADAAA 292 Query: 186 EIQMIKEK 209 + +K+K Sbjct: 293 KSVGLKDK 300 >ref|XP_008361373.1| PREDICTED: uncharacterized protein LOC103425075 [Malus domestica] Length = 302 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/68 (48%), Positives = 43/68 (63%) Frame = +3 Query: 6 LHFMKGGCEGIGAWVFNSVMNGAILLLILNFYVKMHLNKSRTSSPSLTMQSDSLGLNVNG 185 +HFMKGGC GIGAWVFNSV+NG ILL LNFYV++HL + S + G + Sbjct: 233 MHFMKGGCNGIGAWVFNSVLNGVILLAFLNFYVRIHLGFFNKKGKARGASSGAGGADAAA 292 Query: 186 EIQMIKEK 209 + +K+K Sbjct: 293 KSVGLKDK 300