BLASTX nr result
ID: Aconitum23_contig00038753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00038753 (454 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010087969.1| hypothetical protein L484_016839 [Morus nota... 91 3e-16 ref|XP_008223927.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 87 6e-15 ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 ref|XP_007212775.1| hypothetical protein PRUPE_ppa019758mg [Prun... 84 3e-14 ref|XP_011077715.1| PREDICTED: pentatricopeptide repeat-containi... 84 5e-14 ref|XP_012473083.1| PREDICTED: pentatricopeptide repeat-containi... 83 7e-14 ref|XP_008391582.1| PREDICTED: pentatricopeptide repeat-containi... 83 9e-14 ref|XP_010277199.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 ref|XP_014502059.1| PREDICTED: pentatricopeptide repeat-containi... 80 6e-13 gb|KOM39850.1| hypothetical protein LR48_Vigan04g004800 [Vigna a... 80 8e-13 ref|XP_004148334.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_007138785.1| hypothetical protein PHAVU_009G237200g [Phas... 79 2e-12 ref|XP_007014387.1| Pentatricopeptide repeat superfamily protein... 78 3e-12 emb|CDP15640.1| unnamed protein product [Coffea canephora] 75 2e-11 ref|XP_012835829.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-11 ref|XP_008451327.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 73 9e-11 ref|XP_011462363.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_010052558.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_011017641.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_010451905.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 >ref|XP_010087969.1| hypothetical protein L484_016839 [Morus notabilis] gi|587840347|gb|EXB30979.1| hypothetical protein L484_016839 [Morus notabilis] Length = 1240 Score = 90.9 bits (224), Expect = 3e-16 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 4/106 (3%) Frame = -1 Query: 313 GFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINT---NQS 143 GFTPTLK N+FLTFLF AR+F ++H FSQ SN +T NS+THSI + L+N ++ Sbjct: 16 GFTPTLKPLNQFLTFLFQARKFKLIIHLFSQANSNGITGNSETHSIFTWALLNLRKYKEA 75 Query: 142 HHFM-PHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 FM H +K+ +WD+LI+ C+ ++ PE A VL +Y K Sbjct: 76 EQFMKTHMVKSSDFWNTRLWDTLIRGFCTDKKDPEKALIVLKEYQK 121 >ref|XP_008223927.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Prunus mume] Length = 1077 Score = 86.7 bits (213), Expect = 6e-15 Identities = 50/106 (47%), Positives = 64/106 (60%), Gaps = 4/106 (3%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTN---Q 146 +GFTPTLK+ +FL FL RRFN ++HFFSQM SN + NS+T SIL+ L+ + + Sbjct: 43 SGFTPTLKSIIQFLLFLSQTRRFNTVIHFFSQMDSNRIKGNSQTRSILTWALLKLHKYEE 102 Query: 145 SHHFM-PHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVLLDYL 11 + HFM +T IWDSLIQ LC + PE A VL D L Sbjct: 103 AEHFMTTQMAETSKFQSNRIWDSLIQGLCINRKDPEKALLVLRDCL 148 >ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X1 [Citrus sinensis] gi|568840585|ref|XP_006474247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X2 [Citrus sinensis] Length = 1074 Score = 86.3 bits (212), Expect = 8e-15 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 4/106 (3%) Frame = -1 Query: 313 GFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTN---QS 143 GFTPTL + NKFL +L +RFN+++HFFSQ+ SNH+ PNS+THS + L+ + ++ Sbjct: 28 GFTPTLNSINKFLLWLSQNKRFNFVIHFFSQLNSNHIKPNSQTHSTFAWALLKLHKFEEA 87 Query: 142 HHFM-PHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 +HF+ KT Q +DSLIQ PE A VL D L+ Sbjct: 88 YHFLYTQVTKTSFPHQSRFFDSLIQGFFIKRNDPEKALLVLKDCLR 133 >ref|XP_007212775.1| hypothetical protein PRUPE_ppa019758mg [Prunus persica] gi|462408640|gb|EMJ13974.1| hypothetical protein PRUPE_ppa019758mg [Prunus persica] Length = 1104 Score = 84.3 bits (207), Expect = 3e-14 Identities = 49/106 (46%), Positives = 63/106 (59%), Gaps = 4/106 (3%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTN---Q 146 +GFTPTLK+ +FL FL RRFN ++H FSQM SN + NS+T SIL+ L+ + + Sbjct: 48 SGFTPTLKSIIQFLLFLSQTRRFNTVIHLFSQMDSNRIKGNSQTRSILTWALLKLHKYEE 107 Query: 145 SHHFM-PHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVLLDYL 11 + HFM +T IWDSLIQ LC + PE A VL D L Sbjct: 108 AEHFMRTQMAETSKFQSNRIWDSLIQGLCINRKDPEKALLVLRDCL 153 >ref|XP_011077715.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Sesamum indicum] gi|747062413|ref|XP_011077717.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Sesamum indicum] gi|747062415|ref|XP_011077718.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Sesamum indicum] gi|747062417|ref|XP_011077719.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Sesamum indicum] gi|747062419|ref|XP_011077720.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Sesamum indicum] gi|747062421|ref|XP_011077721.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Sesamum indicum] gi|747062423|ref|XP_011077722.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Sesamum indicum] Length = 1054 Score = 83.6 bits (205), Expect = 5e-14 Identities = 42/108 (38%), Positives = 66/108 (61%), Gaps = 5/108 (4%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQSHH 137 +GFTPTLK SN FL FL+ R+F ++H FSQ+ SN + +++TH+I + L+ N+ + Sbjct: 21 SGFTPTLKDSNNFLLFLYRNRKFKAIIHVFSQVNSNKINADAQTHTIFAKALLKENK-YE 79 Query: 136 FMPHFLKTGISPQK-----GIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 FLKT + K + DSL+Q +C+ Q PE + +L ++LK Sbjct: 80 EAAEFLKTLVGKSKIFDKNRVLDSLLQGVCTFNQDPERGYSLLKNFLK 127 >ref|XP_012473083.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] gi|823146384|ref|XP_012473084.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] gi|823146386|ref|XP_012473085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] gi|823146388|ref|XP_012473086.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] gi|823146390|ref|XP_012473087.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] gi|823146392|ref|XP_012473089.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Gossypium raimondii] gi|763754684|gb|KJB22015.1| hypothetical protein B456_004G025400 [Gossypium raimondii] Length = 1072 Score = 83.2 bits (204), Expect = 7e-14 Identities = 45/107 (42%), Positives = 63/107 (58%), Gaps = 5/107 (4%) Frame = -1 Query: 313 GFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQSHHF 134 GFTPTLK+ N+ L FL +RRFN ++H FSQ+ SN + PNS+THSIL +L+ ++ Sbjct: 28 GFTPTLKSINQLLLFLSRSRRFNAVIHLFSQLDSNKINPNSQTHSILICSLLKLHKFEE- 86 Query: 133 MPHFLKTGIS-----PQKGIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 H + T +S P+ WDSLIQ + PE +L D L+ Sbjct: 87 AEHLVSTQMSKYPDFPKTRFWDSLIQGFGVIRNNPEKGLLLLKDCLR 133 >ref|XP_008391582.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Malus domestica] Length = 1096 Score = 82.8 bits (203), Expect = 9e-14 Identities = 47/107 (43%), Positives = 65/107 (60%), Gaps = 5/107 (4%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQSHH 137 +GF+PTLK+ +FL FL RRF+ L+HFFSQM SN + +++TH IL+ L+N Q + Sbjct: 40 SGFSPTLKSIVQFLLFLSRTRRFDTLVHFFSQMESNQIKGSAQTHVILTWALLNL-QKYE 98 Query: 136 FMPHFLKTGISPQKGI-----WDSLIQSLCSLEQTPELAFEVLLDYL 11 HF++T + + WDSLIQ LC + PE A VL D L Sbjct: 99 EAEHFMRTRMVEASSLRRNRMWDSLIQGLCVNRKDPEKALLVLRDCL 145 >ref|XP_010277199.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] gi|720068714|ref|XP_010277200.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] gi|720068717|ref|XP_010277201.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] gi|720068721|ref|XP_010277202.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] gi|720068724|ref|XP_010277203.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Nelumbo nucifera] Length = 1092 Score = 82.0 bits (201), Expect = 2e-13 Identities = 44/106 (41%), Positives = 65/106 (61%), Gaps = 3/106 (2%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLI---NTNQ 146 +GF PTLK+ N FL FL RF +LHFFSQM SN + NS+T I++ L+ + Sbjct: 63 SGFIPTLKSLNHFLIFLSRNHRFESVLHFFSQMNSNGINGNSRTQCIVARALLYEKRLEE 122 Query: 145 SHHFMPHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 + +F+ K G+ P+K + DSLI+ LC+ + PE AF +L + L+ Sbjct: 123 AENFVAQMEKHGVFPKKWLLDSLIRGLCTDGRDPEKAFYLLQNCLR 168 >ref|XP_014502059.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Vigna radiata var. radiata] gi|950980398|ref|XP_014502060.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Vigna radiata var. radiata] gi|950980404|ref|XP_014502061.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Vigna radiata var. radiata] Length = 1064 Score = 80.1 bits (196), Expect = 6e-13 Identities = 44/100 (44%), Positives = 59/100 (59%), Gaps = 3/100 (3%) Frame = -1 Query: 313 GFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLI---NTNQS 143 GFTPT K N+FL FLFH ++FN + HFFSQ+ +N+ N +T S+L+ L+ N Q+ Sbjct: 17 GFTPTPKPINRFLLFLFHLQKFNLITHFFSQLQTNNAPTNPRTLSLLTWALLKSHNFEQA 76 Query: 142 HHFMPHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVL 23 FM LK +WD+LIQ LC+ PE A VL Sbjct: 77 EKFMHTHLKI---THPFMWDTLIQGLCAQRHDPEKALSVL 113 >gb|KOM39850.1| hypothetical protein LR48_Vigan04g004800 [Vigna angularis] Length = 1064 Score = 79.7 bits (195), Expect = 8e-13 Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 3/100 (3%) Frame = -1 Query: 313 GFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTN---QS 143 GFTPT K N+FL FLFH ++FN + HFFSQ+ +N+ N +T S+L+ L+ ++ Q+ Sbjct: 17 GFTPTPKPINRFLLFLFHLQKFNLITHFFSQLQTNNAPTNPRTLSLLTWALLKSHKFEQA 76 Query: 142 HHFMPHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVL 23 FM LK +WD+LIQ LC+ PE A VL Sbjct: 77 EQFMHTHLKI---THPFMWDTLIQGLCAQRHDPEKALSVL 113 >ref|XP_004148334.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Cucumis sativus] gi|778667563|ref|XP_011648947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Cucumis sativus] gi|778667567|ref|XP_011648948.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Cucumis sativus] gi|778667570|ref|XP_011648949.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Cucumis sativus] gi|700206052|gb|KGN61171.1| hypothetical protein Csa_2G060520 [Cucumis sativus] Length = 1085 Score = 79.3 bits (194), Expect = 1e-12 Identities = 42/105 (40%), Positives = 65/105 (61%), Gaps = 5/105 (4%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQSHH 137 +GF+PTLK+ N F FL+H RRF+Y++HFF Q+ +N + NSKTH ILS L+ +++ + Sbjct: 35 SGFSPTLKSINHFFRFLYHNRRFDYVIHFFYQLNANQIKGNSKTHLILSWALLKSHK-YD 93 Query: 136 FMPHFLKT-----GISPQKGIWDSLIQSLCSLEQTPELAFEVLLD 17 + LKT I + +W+ LI+ +C ++ P A VL D Sbjct: 94 DLEQILKTQMLVSSIFHRNRLWNLLIRGICVNKEDPGKALWVLQD 138 >ref|XP_007138785.1| hypothetical protein PHAVU_009G237200g [Phaseolus vulgaris] gi|561011872|gb|ESW10779.1| hypothetical protein PHAVU_009G237200g [Phaseolus vulgaris] Length = 1036 Score = 78.6 bits (192), Expect = 2e-12 Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 3/100 (3%) Frame = -1 Query: 313 GFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTN---QS 143 GFTPT K N+FL FLFH ++FN + HFFSQ+ +N+ N +T S+L+ L+ ++ Q+ Sbjct: 17 GFTPTPKPINRFLLFLFHLQKFNLISHFFSQLQTNNAPTNPRTLSLLAWALLKSHKFEQA 76 Query: 142 HHFMPHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVL 23 FM LK +WD+LIQ LC+ PE A VL Sbjct: 77 EQFMHTHLKI---THPFMWDTLIQGLCTQRLDPEKALSVL 113 >ref|XP_007014387.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508784750|gb|EOY32006.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 1087 Score = 77.8 bits (190), Expect = 3e-12 Identities = 42/106 (39%), Positives = 62/106 (58%), Gaps = 5/106 (4%) Frame = -1 Query: 313 GFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQSHHF 134 GFTPTLK+ N+ L FL + +RFN ++H FSQ+ SN++ NS+THSIL+ L ++ Sbjct: 31 GFTPTLKSVNRLLLFLSNTQRFNSIIHLFSQLESNNIKANSQTHSILTWALFKLHKFEE- 89 Query: 133 MPHFLKTGIS-----PQKGIWDSLIQSLCSLEQTPELAFEVLLDYL 11 H + T +S P+ WDSLIQ ++ PE +L +L Sbjct: 90 AEHLMTTQLSNSSNCPKTRFWDSLIQGFGVIQSNPEKGLLLLKHWL 135 >emb|CDP15640.1| unnamed protein product [Coffea canephora] Length = 1065 Score = 75.1 bits (183), Expect = 2e-11 Identities = 41/107 (38%), Positives = 60/107 (56%), Gaps = 4/107 (3%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQ--- 146 +GFTPTLK N FL FL ++ ++L+ FSQ++SN + NS+T +I + L+ + Sbjct: 11 SGFTPTLKDFNNFLFFLSQTQKSKFILYLFSQISSNKIKGNSQTLTIFTKALLKEQKYEE 70 Query: 145 -SHHFMPHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 H H +T I Q I+++LIQ C E PE VL D+LK Sbjct: 71 ALHFLRTHMGRTKILDQNRIFETLIQGFCRKENDPEKGLYVLRDFLK 117 >ref|XP_012835829.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Erythranthe guttatus] gi|604334669|gb|EYU38753.1| hypothetical protein MIMGU_mgv1a000602mg [Erythranthe guttata] Length = 1048 Score = 73.9 bits (180), Expect = 4e-11 Identities = 41/104 (39%), Positives = 62/104 (59%), Gaps = 1/104 (0%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQSHH 137 +GFTPTLK N FL +RF ++H FSQ++SN + +++T +I + LI ++ + Sbjct: 10 SGFTPTLKDFNNLFLFLSRNQRFKAIIHVFSQLSSNQINADAQTRTIFAKALIKDSR-YE 68 Query: 136 FMPHFLKT-GISPQKGIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 FL+T I Q ++DSLIQ+LC+ Q PE +L D LK Sbjct: 69 EAADFLRTHEIFHQNRVFDSLIQALCTCNQDPERGLSLLKDSLK 112 >ref|XP_008451327.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Cucumis melo] Length = 1085 Score = 72.8 bits (177), Expect = 9e-11 Identities = 38/104 (36%), Positives = 60/104 (57%), Gaps = 4/104 (3%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQ--- 146 +GF+PTLK+ N F FL+H RRF+ ++HFF Q+ +N + N KTH IL+ L+ +++ Sbjct: 36 SGFSPTLKSINHFFRFLYHNRRFDCVIHFFYQLNANQIKGNFKTHLILTWALLKSHKYDD 95 Query: 145 -SHHFMPHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVLLD 17 L + I + +W+ LI+ +C + PE A VL D Sbjct: 96 AEQILKTQMLVSSIFHRNRLWNLLIRGICVNKGDPEKALWVLQD 139 >ref|XP_011462363.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Fragaria vesca subsp. vesca] gi|764568808|ref|XP_011462364.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Fragaria vesca subsp. vesca] Length = 1081 Score = 72.4 bits (176), Expect = 1e-10 Identities = 43/106 (40%), Positives = 63/106 (59%), Gaps = 4/106 (3%) Frame = -1 Query: 313 GFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTN---QS 143 GFTPTL + +FL FL H+RRFN +L+FFSQM SN + NS+T SIL+ L+ + ++ Sbjct: 39 GFTPTLNSIIQFLLFLSHSRRFNTVLNFFSQMESNQIKGNSQTRSILTRALLKLHKYEEA 98 Query: 142 HHFM-PHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 HFM K P+ +WD++ ++ P+ A VL D L+ Sbjct: 99 EHFMRTQMAKASNFPRNRMWDTI------NKKDPDKALLVLRDCLR 138 >ref|XP_010052558.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Eucalyptus grandis] Length = 1074 Score = 72.4 bits (176), Expect = 1e-10 Identities = 39/106 (36%), Positives = 57/106 (53%), Gaps = 4/106 (3%) Frame = -1 Query: 313 GFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTN---QS 143 GFTPT+K N L FL + RF+ ++H SQ+ N++ PNS+THSI + L+ + ++ Sbjct: 32 GFTPTIKHFNLHLLFLSRSHRFDSIVHLVSQLEKNNVHPNSRTHSIFTRALLELHKFEEA 91 Query: 142 HHFM-PHFLKTGISPQKGIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 FM KT + IWD +IQ C PE A + D L+ Sbjct: 92 EQFMRSQMAKTSNFAKSRIWDCIIQGYCVHRNDPERAMSIFRDCLR 137 >ref|XP_011017641.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Populus euphratica] gi|743805463|ref|XP_011017642.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Populus euphratica] gi|743805465|ref|XP_011017643.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Populus euphratica] gi|743805469|ref|XP_011017644.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Populus euphratica] gi|743805473|ref|XP_011017645.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Populus euphratica] gi|743805477|ref|XP_011017646.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Populus euphratica] gi|743805481|ref|XP_011017647.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Populus euphratica] Length = 1075 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/108 (33%), Positives = 60/108 (55%), Gaps = 5/108 (4%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQSHH 137 +GF+PTLK+ N+FL FL ++++ + HFF Q+ N + N +THS+ + L+ + Sbjct: 20 SGFSPTLKSINQFLHFLSKSQKYELITHFFCQINRNKIKCNPQTHSVFTCALLKLEKFEE 79 Query: 136 FMPHFLKTGISPQK-----GIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 HF+KT + G+WDSLI+ ++ PE +L D L+ Sbjct: 80 -AEHFMKTQMEKSSKVSGFGVWDSLIRGFSVNKKDPEKGLSILKDCLR 126 >ref|XP_010451905.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Camelina sativa] gi|727424722|ref|XP_010451911.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Camelina sativa] Length = 969 Score = 71.6 bits (174), Expect = 2e-10 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 5/108 (4%) Frame = -1 Query: 316 TGFTPTLKTSNKFLTFLFHARRFNYLLHFFSQMTSNHLTPNSKTHSILSATLINTNQSHH 137 +GFTPTL + +KFL +L+ ++FNY++HF+SQ+ SN + N + +SI+S +N N+ + Sbjct: 16 SGFTPTLNSIDKFLRYLYRRQKFNYIVHFYSQLDSNQIEINHRVYSIVSWAFLNLNR-YE 74 Query: 136 FMPHFLKTGIS-----PQKGIWDSLIQSLCSLEQTPELAFEVLLDYLK 8 F+ T IS P+ + DSLI P +L D L+ Sbjct: 75 EAEKFINTQISKASIFPRTHMLDSLIHGFSVTRDDPNKGLSILRDCLR 122