BLASTX nr result
ID: Aconitum23_contig00038342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00038342 (460 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMT13370.1| hypothetical protein BVRB_4g084070 [Beta vulgaris... 44 6e-06 >gb|KMT13370.1| hypothetical protein BVRB_4g084070 [Beta vulgaris subsp. vulgaris] Length = 328 Score = 43.5 bits (101), Expect(2) = 6e-06 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 4/100 (4%) Frame = +1 Query: 1 GEDHRLSLGAFAETLGLSNSGL----KYIPQSFDEHEFTRKICFKKKEAGEANVPLMYNS 168 G H LS+ +E G GL + F+ F R + Y+ Sbjct: 3 GSPHTLSIKQVSEAFGFPRGGLIGPHNSYSRQFNSGHFWRLLTSL----------FTYDP 52 Query: 169 SNTKSTLIYNPALRYVQKALAQSIFSRGDSAGAIREIEMY 288 +K+ I NP RYV + LA +F+RGDS+G + E+Y Sbjct: 53 RPSKAAGIINPGFRYVHRLLASILFARGDSSGVVSLRELY 92 Score = 33.1 bits (74), Expect(2) = 6e-06 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 366 KSDGEINIGGFITIMATSLGFDVSPL 443 K +GEI IGG I+I A LG+D+S L Sbjct: 119 KGNGEITIGGLISIFAICLGYDLSNL 144