BLASTX nr result
ID: Aconitum23_contig00037884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00037884 (648 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002888355.1| expressed protein [Arabidopsis lyrata subsp.... 51 3e-06 >ref|XP_002888355.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297334196|gb|EFH64614.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 90 Score = 51.2 bits (121), Expect(2) = 3e-06 Identities = 29/51 (56%), Positives = 32/51 (62%) Frame = +1 Query: 208 LYRSRKD*ALLS*SYSFIRHAVFSIHSLSGSVVVLQTLPMVWTNPLLHPNV 360 LYRS K +LS +S F LSGSVVVLQTLP +WTNP LH NV Sbjct: 41 LYRSGKQKKMLS-EFSLDTTCYFFHSFLSGSVVVLQTLPRIWTNPFLHTNV 90 Score = 27.3 bits (59), Expect(2) = 3e-06 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 4/30 (13%) Frame = +2 Query: 86 FFLFPYN----LSFSALSIYSLDPSMNWFF 163 FF F +N + + ++ IYSLDP+ N FF Sbjct: 5 FFFFSWNQENWVFYPSIYIYSLDPNWNSFF 34