BLASTX nr result
ID: Aconitum23_contig00037702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00037702 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010257011.1| PREDICTED: uncharacterized protein LOC104597... 60 5e-07 >ref|XP_010257011.1| PREDICTED: uncharacterized protein LOC104597253 [Nelumbo nucifera] Length = 752 Score = 60.5 bits (145), Expect = 5e-07 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = -3 Query: 191 FRTPPPSPNRRATLPVRNRRKYVTNISDPDETRRSSGGTRRQVLVTPVLVIGSCFLRSMV 12 FR+ PP RR +L VR R + N+ + D GG+RR+VLVTP L +G+ FLRSMV Sbjct: 42 FRSIPPHKRRRISLTVRCSRNPLENVENLDRNPGIPGGSRREVLVTPFLAVGAYFLRSMV 101 Query: 11 AKA 3 A+A Sbjct: 102 ARA 104