BLASTX nr result
ID: Aconitum23_contig00037016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00037016 (361 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010418863.1| PREDICTED: uncharacterized protein LOC104704... 44 2e-06 >ref|XP_010418863.1| PREDICTED: uncharacterized protein LOC104704479 [Camelina sativa] Length = 500 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +2 Query: 203 ERWSNFGLDASILRHILVCILILTCSTCGCERNYSVFEKM 322 E WS++G LR + IL LTCS GCERN+S+F+ + Sbjct: 439 EWWSSYGGSTPTLRDFAIRILSLTCSATGCERNWSMFQHL 478 Score = 34.3 bits (77), Expect(2) = 2e-06 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +3 Query: 51 SVQGLFGIP*AIRQRTTIAPSE 116 + GLFGIP AIRQRTT +PSE Sbjct: 418 NASGLFGIPMAIRQRTTKSPSE 439