BLASTX nr result
ID: Aconitum23_contig00036963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00036963 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79593.1| hypothetical protein VITISV_040034 [Vitis vinifera] 43 2e-06 emb|CAN78776.1| hypothetical protein VITISV_029750 [Vitis vinifera] 40 7e-06 emb|CAN63109.1| hypothetical protein VITISV_014303 [Vitis vinifera] 41 7e-06 emb|CAN68550.1| hypothetical protein VITISV_027787 [Vitis vinifera] 39 1e-05 >emb|CAN79593.1| hypothetical protein VITISV_040034 [Vitis vinifera] Length = 736 Score = 42.7 bits (99), Expect(2) = 2e-06 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +1 Query: 325 GNGVHAVKWEIMCKRKEECELGCRSFNALNEALLVK 432 G G+H + WE++C +KE+ LG R + LN+ALL K Sbjct: 477 GGGIHLINWEVVCTQKEKGGLGIRKIDLLNKALLDK 512 Score = 35.4 bits (80), Expect(2) = 2e-06 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +3 Query: 171 RELLSRGGRLTLIKSALSNIPI*VVFLF 254 R+ +S+GGR+TLIKS ++IPI +FLF Sbjct: 430 RQYMSKGGRITLIKSTPASIPIYQLFLF 457 >emb|CAN78776.1| hypothetical protein VITISV_029750 [Vitis vinifera] Length = 763 Score = 39.7 bits (91), Expect(2) = 7e-06 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = +1 Query: 301 FL*RGSKEGNGVHAVKWEIMCKRKEECELGCRSFNALNEALLVK 432 FL G +H + WE++C +KE LG R + LN+ALL K Sbjct: 381 FLWGGGSMERKIHLINWEVVCSQKESGGLGIRKIDLLNKALLGK 424 Score = 36.6 bits (83), Expect(2) = 7e-06 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +3 Query: 171 RELLSRGGRLTLIKSALSNIPI*VVFLF 254 R+ LS+GGR+TLIKS L+N+P+ + LF Sbjct: 337 RQYLSKGGRITLIKSTLANLPVYQLSLF 364 >emb|CAN63109.1| hypothetical protein VITISV_014303 [Vitis vinifera] Length = 704 Score = 41.2 bits (95), Expect(2) = 7e-06 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +1 Query: 301 FL*RGSKEGNGVHAVKWEIMCKRKEECELGCRSFNALNEALLVK 432 FL G G +H + W+++C +KE+ LG R LN+ALL K Sbjct: 399 FLWGGRSXGRKIHLINWKVVCTQKEKXGLGIRRMGLLNKALLGK 442 Score = 35.0 bits (79), Expect(2) = 7e-06 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = +3 Query: 171 RELLSRGGRLTLIKSALSNIPI*VVFLF 254 R+ LS+GGR+TLIKS L++IPI + +F Sbjct: 355 RQYLSKGGRITLIKSTLASIPIYQMSIF 382 >emb|CAN68550.1| hypothetical protein VITISV_027787 [Vitis vinifera] Length = 752 Score = 39.3 bits (90), Expect(2) = 1e-05 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = +1 Query: 301 FL*RGSKEGNGVHAVKWEIMCKRKEECELGCRSFNALNEALLVK 432 FL G +H + WE++C +KE LG R + LN+ALL K Sbjct: 557 FLWGGGSMERKIHLINWEVVCTQKESGGLGIRKIDLLNKALLGK 600 Score = 36.6 bits (83), Expect(2) = 1e-05 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = +3 Query: 171 RELLSRGGRLTLIKSALSNIPI*VVFLF 254 R+ LS+GGR+TLIKS L+N+PI + LF Sbjct: 513 RQYLSKGGRITLIKSTLANMPIYQLSLF 540