BLASTX nr result
ID: Aconitum23_contig00036369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00036369 (443 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277432.1| PREDICTED: uncharacterized protein LOC100247... 58 3e-06 ref|XP_002524652.1| conserved hypothetical protein [Ricinus comm... 57 5e-06 >ref|XP_002277432.1| PREDICTED: uncharacterized protein LOC100247380 [Vitis vinifera] gi|731419103|ref|XP_010660907.1| PREDICTED: uncharacterized protein LOC100247380 [Vitis vinifera] Length = 175 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/60 (43%), Positives = 33/60 (55%) Frame = -2 Query: 379 ARRREKSGEELVECSGEYCTSCTXXXXXXXXXXXXXXXXXANLVILTFVKVPWMMGRRCL 200 +R + G +L+ECSG+YC SCT NL+ L VK+PWMMGRRCL Sbjct: 26 SRYAVEDGGDLIECSGKYCRSCTAGLFADCVAICCCPCAVVNLLALALVKIPWMMGRRCL 85 >ref|XP_002524652.1| conserved hypothetical protein [Ricinus communis] gi|223536013|gb|EEF37671.1| conserved hypothetical protein [Ricinus communis] Length = 203 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/53 (47%), Positives = 31/53 (58%) Frame = -2 Query: 358 GEELVECSGEYCTSCTXXXXXXXXXXXXXXXXXANLVILTFVKVPWMMGRRCL 200 G +L+ECSG+YC SCT NL+ L FVKVPWM+GR+CL Sbjct: 43 GGDLIECSGKYCRSCTAGLIADCVALCCCPCALVNLLALAFVKVPWMVGRKCL 95